KEGG   Mesorhizobium opportunistum: Mesop_1250Help
Entry
Mesop_1250        CDS       T01542                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
mop  Mesorhizobium opportunistum
Pathway
mop00473  D-Alanine metabolism
mop01100  Metabolic pathways
mop01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mop00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Mesop_1250
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Mesop_1250
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mop01011]
    Mesop_1250
Enzymes [BR:mop01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Mesop_1250
Peptidoglycan biosynthesis and degradation proteins [BR:mop01011]
 Precursor biosynthesis
  Racemase
   Mesop_1250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AEH85733
UniProt: F7YFI8
LinkDB All DBs
Position
1299969..1301108
Genome map
AA seq 379 aa AA seqDB search
MNDASKRSLSGDTAGVSEAAAGAILTIDLGAIRENYRRLKAQLGGVRCAGVVKADGYGLG
ATQVASALMKDGCDTFFVALLAEGISLRKAIGAGPDIYVLNGLPPGSEPEAVAAGLCAVI
NSGAQLKAWRAAAHGAGRQLPAAIQVDSGMSRLGMAPAEVEAVVEDTGAFEGIDVRYVTS
HLACADEPRHPANEQQRLAFERLRALLPAAPASLANSSGIFLGPRYHYDLARPGAALYGI
NPTPDATNPMLPVVGLQAKVAQTRGIEKGTGVGYGHTYHAEGPRSLATISFGYADGWLRR
SASAAWFEGVRLPFLGRVSMDSIILDVSALSPGKLREGDLVELLGPAQSVDDAAGHAGTI
GYEILASLGTRFHRRYVGG
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgcctccaagaggtcgctgtccggggataccgctggcgtaagcgaagcggcg
gcgggagccattctcaccatcgatctcggcgcgatccgtgaaaactaccggcggctgaaa
gcgcaactgggcggcgtacgttgcgccggcgtggtcaaggcagacggctatggtctcggt
gcgacgcaggtggcatcggcgctgatgaaggatggctgcgacactttcttcgtcgcgctg
ctggcggaaggcatcagcctgcgcaaggcgatcggcgccgggccggacatctacgtgctg
aacgggctgccgccgggctcggagccggaagccgtcgccgccggcctgtgcgcggtcatc
aacagcggcgcgcagttgaaggcctggcgcgcggcggcgcatggcgccggccgccagctt
ccggccgccatccaggtcgacagcggcatgtcgcggcttggcatggcgcctgccgaggtc
gaagcggtggtagaggataccggcgcgttcgagggcatcgacgtcaggtatgtgacgagc
catctggcctgcgcagacgagccgcgccatccggccaacgagcagcagcggctggcgttt
gagcggctgcgtgccctgctgccggcggcgcccgcctcgctcgccaattcctccggcatt
ttcctcgggccgcgctaccactacgatctggcccggccgggggcggcgctctacggcatc
aacccgacgcctgacgcgaccaatccgatgctgcccgtggtggggctgcaagccaaggtt
gcgcagacgcgcggcatcgaaaaaggcaccggcgtcggctatggtcacacctatcacgcc
gaaggtccgcgcagcctggcgacgatctcgttcggctatgccgatggctggctgcgccgt
tccgcttcggcggcctggttcgaaggggtgcgcctgcctttcctcgggcgtgtgtccatg
gattcgatcattctcgatgtttccgcactgtcgcccggcaaactgcgcgagggcgacctg
gtcgagctgctgggtcctgcacagagcgtcgacgatgccgccggccatgccggcaccatc
ggatatgaaatcctggccagcctcggcacgcgctttcaccgccgatacgttggcggttga

DBGET integrated database retrieval system