KEGG   Mesorhizobium opportunistum: Mesop_4203Help
Entry
Mesop_4203        CDS       T01542                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mop  Mesorhizobium opportunistum
Pathway
mop00564  Glycerophospholipid metabolism
mop01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mop00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Mesop_4203
Enzymes [BR:mop01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Mesop_4203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 FAD_binding_2 NAD_binding_8 FAD_binding_3 STPPase_N
Motif
Other DBs
NCBI-ProteinID: AEH88636
UniProt: F7Y8A0
LinkDB All DBs
Position
4327286..4328812
Genome map
AA seq 508 aa AA seqDB search
MDASSIRDIFVIGGGINGCGIARDAVGRGFSVFLAEMNDLASGTSSGSTKLIHGGLRYLE
FYEFRLVREALMEREVLWKNAPHIIWPMRFVLPYAKGLRPAWLIRLGLFLYDHIGGRKLL
PATRTLDMASDPAGKPLKPLFKKAFEYSDGWVNDARLVALNARDAADRGATIRTRTKVVE
ARREGGIWAIKIENLQTGATEEIKARLLVNAAGPWVDHVLSGVVGQNDVHNVRLVQGSHI
VIAKKFDDPRAYFFQNRDGRIIFAIPYEEEFTLIGTTDRDYPGDPHDVKISDTEIDYLCA
AASEYFAQPVKRSDIVWTYSAVRPLYDDGASKAQEATRDYVLKADGGDGAAPIVNAFGGK
ITTYRRLSESMLEKIEGFLGKRGKPWTANAPLPGGDFPATGFDAQVAKLKAAYAFLDARL
ARRLTRLYGTRAQVLLGLAKSNADLGRNFGGDLYEAEVRYLVENEWAITAEDVLWRRTKR
GLHLGREQVSALDEFMRGISRRHVAAAE
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
gtggacgcatcttcaatccgtgacattttcgtcataggtggcggcatcaacggctgcggc
atcgcccgcgatgccgtcggtcgtggcttttcggtttttctcgccgagatgaacgatctc
gccagcggaacatcctccggttcgaccaagttgatccatggcgggctgcgctatctcgaa
ttctacgaatttcgcctggtgcgcgaggcgctcatggaacgcgaggttctgtggaagaac
gccccgcacatcatctggccgatgcgcttcgtgctgccctatgccaagggcctgcgcccg
gcctggctgatccggctcggcctgttcctctacgaccatattggcgggcgcaaattgctg
ccggcgaccaggacgctcgacatggcgagcgacccggcgggcaagcccttgaagccattg
ttcaagaaggctttcgaatattcggatggctgggtcaatgatgcacgcctggtggcgctc
aatgcacgcgatgccgccgaccgcggcgcgacgatccgaacccgcaccaaggtggtcgag
gcacgccgcgaaggtggcatctgggcgatcaagatcgagaacctgcagacaggcgcgacc
gaggagatcaaggcaaggctgctggtcaatgctgccggtccatgggtcgatcatgtcctg
tccggcgtcgtcggccagaacgatgtccacaatgtccgcctcgtgcagggcagtcacatc
gtcatcgccaagaaattcgacgatccgcgcgcctatttcttccagaacagggatgggcgc
atcatcttcgccattccctatgaggaagagttcacgctgatcggcaccaccgaccgggac
tatcccggcgatccgcacgacgtgaagatcagcgacaccgagatcgactatctctgcgcc
gcggccagcgagtatttcgcgcaaccggtgaagcgctcggacattgtctggacctattcg
gcggttcgcccgctctatgatgacggcgcctccaaggcgcaggaagcaactcgcgactat
gtgctgaaggccgatggcggcgacggcgcggccccgatcgtcaacgctttcggcggcaag
atcaccacctaccgccggctgtcggaatcgatgctggaaaagatcgaaggttttctcggc
aagcgcggcaagccatggaccgccaacgcgccactgcctgggggtgacttccccgccacc
ggtttcgacgcgcaggtggcaaagctgaaggcggcctatgcgttcctcgacgcgcgcctt
gcccgccggctgacccggctttacgggacgcgtgcacaggtcctgctcggccttgccaag
tcgaatgccgatctcggccgcaatttcggcggcgatctctacgaggccgaagtgcgttat
ctcgttgaaaacgaatgggctatcacggcggaagacgtgctgtggcggcgaaccaagcgc
ggcctgcatcttggccgcgagcaggtttccgcactcgatgaattcatgcgtggcataagc
cggcggcacgtcgcggccgctgaatga

DBGET integrated database retrieval system