KEGG   Mesorhizobium opportunistum: Mesop_4298Help
Entry
Mesop_4298        CDS       T01542                                 

Definition
(GenBank) oligopeptide/dipeptide ABC transporter, ATPase subunit
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
mop  Mesorhizobium opportunistum
Pathway
mop02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mop00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Mesop_4298
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mop02000]
    Mesop_4298
Transporters [BR:mop02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    Mesop_4298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_21 AAA_22 AAA_16
Motif
Other DBs
NCBI-ProteinID: AEH88730
UniProt: F7Y9K4
LinkDB All DBs
Position
4425897..4426856
Genome map
AA seq 319 aa AA seqDB search
MILSVRDLRVSFRTDDGLVRAIDGVSFDLGESEILGVVGESGSGKTVSLLAVMGLITDPN
AVIEGSIRYKGRELVGLPARELRRLRGNEIAMIFQDPMTALTPVYTIGWQIAEQIRAHRN
ISKSKAMERVEELLAEVNFPNPHEAMSRYPHQLSGGMRQRAVIAMALSCNPALLVADEPT
TALDVTVQAGILDLVRKLRATHKSAVVFITHDMGVVSELADRVMVMYAGRVVERGSRMEL
FSDPRHPYTRALLGSIPPLTGEKPRRLPAIPGSPPSLLRLPQGCAFGPRCPVHYEPCATG
KPDLGAGAHAAACFRAVQA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgatactgtcggtgcgtgacctcagagtatccttccggaccgatgacggcctggtgcgg
gccatcgacggcgtttccttcgatcttggggaaagcgagattctcggcgtcgtcggcgaa
tccggttccggcaagaccgtatcgctgctggccgtgatgggcctcatcaccgaccccaat
gccgtcatcgagggctcgatccgttacaagggccgcgagttggtgggactgccggcgcgc
gaactgaggcgcctgcgcggcaacgagatcgcgatgatcttccaggatccgatgacggcg
ctgacgccggtctacacgatcggctggcagatcgccgagcagatccgcgcacatcgaaat
atcagcaaatccaaagcgatggagcgcgtcgaggaactgctggccgaggtgaactttccc
aacccgcacgaggcgatgtcgcgctacccgcaccagctttccggcggcatgcgccagcgg
gcggtgatcgcaatggcgctgtcgtgcaatccggccctgctggtggcggacgagccgacc
accgcgctcgacgtcacggtgcaggccggcattctcgatctcgtgcgcaaattgcgcgcg
acgcataagtcggccgtggtcttcatcacccatgacatgggcgtggtctccgaactcgcc
gaccgcgtcatggtcatgtatgcgggccgcgtggtggaacggggcagccgcatggaactg
ttttccgatccgcgccacccctatacgcgcgcgctgctcggttcgattccgccgctgacc
ggtgaaaaaccgcgccgcctgccggccattcccggctcgccgccgtcgctgctgcgcttg
ccgcagggctgcgctttcggtccgcgttgcccggtccactacgaaccctgcgcgaccggc
aagcccgacctcggggctggagcccacgccgccgcatgcttccgggcggtgcaggcatga

DBGET integrated database retrieval system