KEGG   Mesorhizobium opportunistum: Mesop_4544Help
Entry
Mesop_4544        CDS       T01542                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mop  Mesorhizobium opportunistum
Pathway
mop00010  Glycolysis / Gluconeogenesis
mop00020  Citrate cycle (TCA cycle)
mop00620  Pyruvate metabolism
mop01100  Metabolic pathways
mop01110  Biosynthesis of secondary metabolites
mop01120  Microbial metabolism in diverse environments
mop01130  Biosynthesis of antibiotics
mop01200  Carbon metabolism
Module
mop_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mesop_4544
   00020 Citrate cycle (TCA cycle)
    Mesop_4544
   00620 Pyruvate metabolism
    Mesop_4544
Enzymes [BR:mop01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Mesop_4544
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N Peptidase_M23 QRPTase_N ATP-synt_ab_Xtn
Motif
Other DBs
NCBI-ProteinID: AEH88967
UniProt: F7YCS7
LinkDB All DBs
Position
complement(4675965..4677386)
Genome map
AA seq 473 aa AA seqDB search
MPINITMPALSPTMEEGNLSKWLVKEGDKVSPGDVIAEIETDKATMEVEAVDEGTVAKLV
VPAGTEGVKVNALIAVLAAEGEDAGAAAKSGGAAAAKAEAKRDEAPISPPVGEMSAKPTE
GGAVPPSSQREAPPSGLPSLPPLGISPTGGEIRQSPEGRTFASPLARRIAKEAGVDVSAV
TGTGPHGRVVKADVDAAIAGGGAKAAPAAKAPAGAPAAAPAVKAMSDEQVLKLFEEGSYE
LVPHDNMRKTIARRLVEAKTTIPHFYLTLDCELDALLALRTQINAAAPVKKTDKGEAPAY
KLSVNDMVIKAMALALKAVPDANASWTESAMVKHKHADVGVAVSIPGGLITPIIRHADEK
TLSTISNEMKDLASRARSRKLKPEEYQGGTTAVSNLGMFGIKDFAAVINPPHATILAVGA
GEERAVVKNGEIKIATVMSVTLSTDHRAVDGALGAELLVAFKRLIENPMGMLV
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgccaatcaacatcaccatgccggcgctctcgcccacaatggaagagggcaatctgtca
aagtggctcgtgaaggagggcgacaaggtttcgccgggcgatgtcatagccgagatcgag
accgacaaggcgacgatggaagtcgaagccgtcgatgagggtacggttgcaaagctcgtc
gttccagccggcaccgaaggcgtcaaggtcaacgcgctgatcgccgtgctcgcagccgag
ggcgaggatgcgggggcggcggcaaaaagcggtggtgctgcggcggcgaaggcggaagcc
aagcgagacgaggcgccaatctccccacccgtgggggagatgtcggcgaagccgacagag
gggggcgctgtcccgccgtcctctcagcgcgaggcgcccccctctggcctgccctctttg
ccaccacttggcatctcccccacggggggggagatccgccagtcgccggaaggccgtacc
ttcgcctcgccgctcgcacgccgcatcgccaaggaggccggcgtcgatgtctcggcggtg
accggcacgggcccgcatggccgggtggtgaaagccgatgtcgatgccgcgattgccggc
ggcggtgccaaggcagcaccggcggccaaggccccggctggcgcgccggccgctgctccg
gcggtgaaggcgatgtcggacgaacaggtgctaaaactgttcgaggaaggctcctacgag
ctcgtcccgcacgacaacatgcgcaagaccattgcgcggcgtctggtcgaggccaagacc
accatcccgcatttctacctgacgctcgactgcgagctcgatgcgctcttggcattgcgt
acgcagatcaatgcggcggcgccggtgaagaagaccgacaagggcgaggctcccgcctac
aagctgtcggtcaacgacatggtgatcaaggcgatggcgctggcgctgaaggcggtgcct
gatgccaacgcctcatggaccgaaagcgccatggtcaagcacaagcatgccgatgtcggc
gttgccgtctcgatccccggcggcctgatcacgccgatcatccggcatgcggacgaaaag
acgctgtccaccatctccaacgagatgaaggacctggcaagccgggcccgcagccgcaag
ctgaagccggaagagtatcagggcggcacgacggcggtgtcgaacctcggcatgttcggc
atcaaggactttgccgccgtcatcaacccgccgcatgcgacgatcctggctgtgggtgcc
ggcgaggagcgggcggtggtcaagaacggcgagatcaaaatcgcgaccgtgatgtcggtg
acgctgtcgaccgatcatcgcgccgttgacggagcgctgggcgccgaactgctggtcgcc
ttcaagcggctgatcgaaaatccgatgggcatgctggtctaa

DBGET integrated database retrieval system