KEGG   Mesorhizobium opportunistum: Mesop_4623Help
Entry
Mesop_4623        CDS       T01542                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
mop  Mesorhizobium opportunistum
Brite
KEGG Orthology (KO) [BR:mop00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mop03012]
    Mesop_4623
   03029 Mitochondrial biogenesis [BR:mop03029]
    Mesop_4623
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mop04147]
    Mesop_4623
Translation factors [BR:mop03012]
 Eukaryotic Type
  Elongation factors
   Mesop_4623
 Prokaryotic Type
   Mesop_4623
Mitochondrial biogenesis [BR:mop03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Mesop_4623
Exosome [BR:mop04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Mesop_4623
  Exosomal proteins of breast cancer cells
   Mesop_4623
  Exosomal proteins of colorectal cancer cells
   Mesop_4623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AEH89044
UniProt: F7YDU3
LinkDB All DBs
Position
complement(4745202..4746377)
Genome map
AA seq 391 aa AA seqDB search
MAKGKFERTKPHVNIGTIGHVDHGKTSLTAAITKYFGEYKRYDQIDAAPEEKARGITIST
AHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQ
VGVPSIVVFLNKVDQVDDAELLELVELEVRELLSKNEFPGDDIPIVKGSALAALEDSNKT
IGEDAIRELMAQVDAYIPTPVRPLDKPFLMPIEDVFSISGRGTVVTGRVERGVVKVGEEL
EIIGIRPTTKTTCTGVEMFRKLLDQGQAGDNIGALLRGVDREGVERGQVLAKPGTVKPHK
KFVAEAYILTKDEGGRHTPFFTNYRPQFYFRTTDVTGIVSLPEGTEMVMPGDNITVDVEL
IVPIAMEEKLRFAIREGGRTVGAGIVVTIKE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaggtaaattcgagcgcactaagcctcatgtgaacatcggcacgatcggtcac
gtcgatcatggcaagacgtcgctgacggcggcgatcacgaagtattttggcgaatacaag
cgctatgaccagatcgatgcggcgcccgaggagaaggcgcgcggcatcacgatctcgacg
gcgcacgtcgaatacgagacggccaaccgccactacgcccacgtcgactgccccggccac
gccgactatgtgaagaacatgatcaccggtgccgcgcagatggacggcgcgatcctggtg
gtgtcggccgccgacggcccgatgccgcagacccgcgagcacatcctcttggcccgtcag
gtcggcgtgccgtcgatcgtggtgttcctgaacaaggtcgaccaggtcgacgacgccgag
ctgctcgaactggtcgagctcgaggttcgcgagcttctgtcgaagaatgagttccccggc
gacgacattccgatcgtcaagggttcggcactggccgcgcttgaggattcgaacaagacc
atcggcgaggacgcgatccgcgagctgatggctcaggtcgacgcctacatcccgaccccg
gttcgtccgctcgacaagccgttcctgatgccgatcgaggacgtgttctcgatttcgggc
cgcggcacggtggtgaccggccgcgtcgagcgcggcgtggtcaaggtcggcgaggagctg
gagatcatcggcatccgtccgacgaccaagacgacctgcacgggcgtggagatgttccgc
aagctgctcgaccagggccaggccggcgacaacatcggcgcgctgttgcgcggcgttgac
cgtgaaggtgtcgagcgcggccaggttctggccaagccgggcacggtgaagccgcacaag
aagttcgtggccgaagcctacatcctgaccaaggacgaaggtggccgtcacacgccgttc
ttcaccaactaccgtccgcagttctacttccgcaccacggacgtgaccggcatcgtgtcg
ctgccggaaggcaccgagatggtgatgcccggcgacaacatcacggtcgatgtcgagctg
atcgtgccgatcgccatggaagagaagctgcgcttcgccatccgtgaaggcggccgcacc
gtcggtgccggcatcgtcgtcaccatcaaagagtaa

DBGET integrated database retrieval system