KEGG   Mesorhizobium opportunistum: Mesop_5417Help
Entry
Mesop_5417        CDS       T01542                                 

Definition
(GenBank) Manganese/iron superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mop  Mesorhizobium opportunistum
Brite
Enzymes [BR:mop01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Mesop_5417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AEH89833
UniProt: F7Y8N2
LinkDB All DBs
Position
complement(5526486..5527085)
Genome map
AA seq 199 aa AA seqDB search
MAFELPALPYDYEALQPYMSKETLEYHHDKHHKAYVDNGNKLAAEAGLGDLSVEEVVKQS
FGKNAGLFNNAAQHYNHIHFWKWMKKGGGGNKLPGALQKAVDSDLGGYDKFKADFIAAGT
TQFGSGWAWVSVKDGKLAISKTPNGENPLVHGASPILGVDVWEHSYYIDYRNARPKYLEA
FVDSLINWDHVLEMYEKAK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattgcccgctctgccctatgactacgaggccttgcagccttacatgtcg
aaggagacgctggaatatcatcacgacaagcaccacaaggcctacgtcgataacggcaac
aagctggccgccgaggccggcttgggcgatctgtcggtcgaagaggtggtcaagcagtcg
ttcggcaagaatgccggtctcttcaacaatgccgcgcaacactacaaccacatccatttc
tggaagtggatgaagaagggcggcggcggcaacaagctgcccggcgcactgcagaaggcg
gtcgacagcgacctcggcggttacgacaagttcaaggccgacttcatcgccgccggcacg
acgcagttcggttcgggctgggcctgggtctcggtcaaggacggcaagctggcgatctcg
aagaccccgaacggtgaaaatccgctcgtccacggcgcatcgccgatcctcggcgtcgac
gtctgggaacattcctattacatcgactatcgcaacgcccggccgaaatatctcgaggcg
ttcgtcgacagcctcatcaactgggaccacgtcctggagatgtacgaaaaggcgaagtga

DBGET integrated database retrieval system