KEGG   Mesorhizobium opportunistum: Mesop_5775Help
Entry
Mesop_5775        CDS       T01542                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
mop  Mesorhizobium opportunistum
Pathway
mop00630  Glyoxylate and dicarboxylate metabolism
mop00710  Carbon fixation in photosynthetic organisms
mop01100  Metabolic pathways
mop01120  Microbial metabolism in diverse environments
mop01200  Carbon metabolism
Module
mop_M00165  Reductive pentose phosphate cycle (Calvin cycle)
mop_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:mop00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Mesop_5775
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mesop_5775
Enzymes [BR:mop01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Mesop_5775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AEH90184
UniProt: F7YE20
LinkDB All DBs
Position
5915525..5916775
Genome map
AA seq 416 aa AA seqDB search
MITLTYRIETSGSIEALAAKIASDQSTGTFVALPGETEELKARVAARVLAIRHLPDAEQP
SIPEAGTGPFRRADVDIAFPFDAIGTDLSALMTIAIGGTYSIKGLSGIRVVDMKLPQEFR
GAHPGPQFGVAGSRRLTGVEGRPIIGTIVKPALGLRPHETAAMVGELIAAGVDFIKDDEK
LMSPAYSPLAERVKAIMPLILDHEQKTGKKVMYAFGISHADPDEVMRNHDMVLKAGGNCA
VININSIGFGGMAYLRKRSGLVLHAHRNGWDILTRHPGLGMDFKVWQQFWRLLGVDQFQI
NGIASKYWEPDASFIASFEAVTTPLFSPDDCALPVAGSGQWGGQAPETYERTGRTVDLLY
LCGGGIVSHPDGPGAGVRAVQQAWQAAVEGISLADYASSHVELARSIEKFGDGKAA
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccctcacctatcgcatcgaaacctcaggcagcatagaagccctggcggccaag
atcgccagcgaccagtcgaccggcaccttcgttgcgctgcccggcgagaccgaagagctg
aaggcgcgcgtggcggcacgggtgctggcgatccggcacctgcccgatgcggagcagccg
tccattcccgaggccggaaccgggcctttcaggcgcgccgatgtcgatatcgcctttccg
ttcgatgccatcggcaccgacctctcggcgctgatgaccatcgcgatcggtggcacctat
tcgatcaagggcctgtcgggcatccgcgtcgttgacatgaagctgccgcaagaattcagg
ggcgcccatccggggccgcaattcggcgttgccggcagccgcaggctgaccggtgtcgag
ggccgtccgatcatcggcaccatcgtcaagccggcgctgggcctgcgaccgcacgagacg
gccgccatggtcggcgaactgatcgcggccggcgtcgatttcatcaaggacgatgagaag
ctgatgagcccggcctactcgccactggcggagcgggtgaaggcgatcatgccgctgatc
ctcgatcacgagcagaagaccggcaagaaggtgatgtatgccttcggcatctcgcatgcc
gacccggacgaggtgatgcgcaaccacgatatggtgctcaaggccggcggcaattgcgcg
gtcatcaacatcaactcaatcggcttcggcggcatggcttacctcagaaagcgttccggc
ctggtgctgcatgcccaccgcaacggctgggacatcctgacccgccatcccggcctcggc
atggacttcaaggtctggcagcagttctggcggctgctcggcgtcgaccagttccagatc
aacggcatcgcctcgaaatactgggagccggacgcatctttcattgcctccttcgaggcg
gtgacgacgccgctgttctcacctgatgattgcgctctgccggtcgccggttcgggccaa
tggggcggacaggcgcccgagacctacgagcgcaccgggcgcacggtcgatctgctctat
ctctgcggcggcggcatcgtcagccatccggacggcccgggtgccggcgtgcgcgccgtc
cagcaggcctggcaggccgccgtcgagggtatttccttggcggactacgcaagcagccat
gtcgaactggcgcgctcgatcgagaagttcggcgacggcaaggccgcgtga

DBGET integrated database retrieval system