KEGG   Mesorhizobium opportunistum: Mesop_5874Help
Entry
Mesop_5874        CDS       T01542                                 

Definition
(GenBank) acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
mop  Mesorhizobium opportunistum
Pathway
mop00220  Arginine biosynthesis
mop01100  Metabolic pathways
mop01110  Biosynthesis of secondary metabolites
mop01130  Biosynthesis of antibiotics
mop01210  2-Oxocarboxylic acid metabolism
mop01230  Biosynthesis of amino acids
Module
mop_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:mop00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Mesop_5874
Enzymes [BR:mop01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     Mesop_5874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AEH90282
UniProt: F7YG97
LinkDB All DBs
Position
complement(6020912..6022213)
Genome map
AA seq 433 aa AA seqDB search
MPERIADEAILGAVDDGFARQVAFLQDLVRFPSQRGEEHAAQSFMAAAYEADGYEVDMWR
VDVDAIRDLPGFSPVAVSYDDAFNVVATHTPKNATGRSLILNGHIDVVPTGPLDRWVRDP
YDPAIEDGWMHGRGAGDMKAGLSACLYALAALRNLGYQPAAKLFLQSVVEEECTGNGALA
CLQRGYHADAVFIPEPLEPRLMRAQVGPIWFRVEVDGDPQHASGAFSAGANAIEKAFVII
QALKQLEIVWNARKVDDPHFCDHPHPIRFNLGKIEGGEWTSSVPARCVFEMRVATYPGQK
LEDARAELEACIADAARADPFLANRPPRMTYNGFMAEGYVLEGADEMEAVLRRSHSAVWG
EPLTEHVTSATTDARFFGLYADTPAIVYGPICRMPHGYDEAVDLDSVRKVTQTIALFIAD
WCGLEPIDPKVRS
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagcgaattgcggacgaggccattctgggcgcggtcgacgatggcttcgcgcgg
caggtcgcgtttctgcaggatctcgtgcgctttccttcgcagcgaggcgaggagcacgcc
gcgcaatcgttcatggcggccgcctatgaggccgatggctacgaggtcgacatgtggcgc
gtcgatgtcgatgctattcgcgacctgccgggtttttcgcctgtggcggtgtcctacgac
gacgccttcaatgtcgttgccacccacacgccgaaaaacgcgaccggccgctcgttgatc
ctcaacggccatatcgacgtggtgccgacaggaccgctcgaccgctgggtgcgcgatccc
tacgatccggcgatcgaggatggctggatgcatggtcgtggcgccggcgacatgaaggcc
ggcctgtcggcctgtctctacgcattggccgcattgcgcaatctcggttaccagccggcc
gcgaaattattcctgcagtcggtggtcgaggaggaatgcaccggtaatggcgcgctcgcc
tgcctgcagcgcggctaccacgccgatgccgttttcatacccgaaccgctggagcccagg
ctgatgcgggcgcaggtcggaccgatctggttcagggtcgaggtcgacggcgatccgcag
catgcgtcgggggccttttccgctggcgccaacgcaatcgaaaaggccttcgtcattatt
caggcgctgaagcagctcgaaatcgtctggaatgcgcgcaaggtcgatgatccgcatttc
tgcgatcacccgcatccgatccgcttcaatctcggcaagatcgaaggcggcgagtggacg
tcgagcgtcccggcgcgctgcgtcttcgagatgcgggtcgcgacctatcccggccagaag
cttgaggacgccagggccgaactcgaggcctgcatcgccgatgcggcccgcgccgatccg
ttcctcgccaatcgcccacccaggatgacctacaacggcttcatggccgaaggctatgtg
ctggaaggcgccgacgagatggaagccgtgctgcgccgcagccatagcgccgtgtggggc
gagccgctgaccgagcatgtgacctcggcgaccacggacgctcgcttcttcggcctctat
gccgacacgccggcgatcgtctatggtccgatctgccgcatgccgcatggctatgacgag
gccgtcgatctcgactcggtgcgcaaagttacccagacgattgccttgttcatcgccgac
tggtgcggtcttgagccgatcgatccgaaggtgagatcatga

DBGET integrated database retrieval system