KEGG   Mesorhizobium opportunistum: Mesop_6021Help
Entry
Mesop_6021        CDS       T01542                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
mop  Mesorhizobium opportunistum
Pathway
mop00010  Glycolysis / Gluconeogenesis
mop00620  Pyruvate metabolism
mop01100  Metabolic pathways
mop01110  Biosynthesis of secondary metabolites
mop01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mesop_6021
   00620 Pyruvate metabolism
    Mesop_6021
Enzymes [BR:mop01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Mesop_6021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AEH90427
UniProt: F7Y061
LinkDB All DBs
Position
6188858..6190375
Genome map
AA seq 505 aa AA seqDB search
MNKVEFSRPVKAPFDKRYGNFIGGKWAEPRSGRYFENYSPVNGQLLCEVARSDGQDIEAA
LDAAHAAKDAWARTSVAERSLILNRIADRMEENLDLLACAETWDNGKPIRETTAADLPLA
IDHFRYFAGAVRGQEGSLSQIDDDTVAYHFHEPLGVVGQIIPWNFPLLMACWKLAPALAA
GNCVVLKPAEQTPAAILLWADLVGDLLPPGVLNIVNGFGLEAGKPLASSPRIAKIAFTGE
TTTGRLIMQYASQNLIPVTLELGGKSPNIFFKDVVAEDDDFFDKAIEGFVMFALNQGEVC
TCPSRALIQESIYDRFMERALKRVEAIVQGDPLDPATMIGAQASSEQMEKILSYIDIGRQ
EGAELLTGGARNLLPGDLAGGYYVQPTVFKGHNKMRIFQEEIFGPVVSVTTFKDDDEALA
IANDTLYGLGAGVWTRDANRAYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRETH
KMMLDHYQQTKNMLVSYSPKKLGFF
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaggttgaattctcacgcccggtcaaagcgcccttcgacaagcgctacggcaat
ttcatcggtggcaaatgggccgagccccgctccggccgctacttcgaaaactactcgccg
gtgaatggccaactgctgtgcgaagtagcgcgctcggacggccaggacatcgaggcggcc
ctggacgccgcgcatgccgccaaggatgcctgggcgcgcaccagcgtggccgagcgctcc
ctcatcctcaaccgcatcgccgatcgaatggaggaaaacctcgatctcctcgcatgcgcc
gagacctgggacaacggcaagccgatccgcgaaacgaccgcggccgacctgcctttggcc
atcgaccatttccgctatttcgccggcgcggtgcgtggccaggaaggcagcctctcccag
atcgacgacgacaccgtcgcctatcatttccatgagccgctcggcgtggtcggccagatc
atcccgtggaacttcccgttgctgatggcatgctggaaacttgctcccgcgcttgccgcc
ggcaattgcgtcgtcctgaaacctgccgagcagaccccggctgccatcctgctctgggcc
gatcttgtcggcgacctgctgccgccgggcgtgctcaacatcgtcaacggctttggcctc
gaggccggcaagccgctggcttcgtcgccgcgcattgccaagatcgcctttaccggcgag
acgacgacgggccggctgatcatgcagtatgccagccagaacctgatcccggtgacgctc
gagctcggcggcaagtcacccaacattttcttcaaggatgtcgtcgccgaggacgacgat
ttcttcgacaaggcgatcgaaggcttcgtcatgttcgcgctgaaccagggcgaggtgtgc
acctgtccgagccgcgcgctcatccaggaatcgatctacgaccggttcatggaacgcgcc
ctcaagcgcgtcgaggcaatcgtgcagggcgatccgctcgatccggcaacgatgatcggg
gcccaggcttcgtccgagcagatggaaaagatcctgtcctatatcgatatcggccgccag
gaaggagccgagttgctgaccggtggggcgcgcaatcttctgcccggcgacctggccggc
ggctactacgtgcaacccacggtgttcaagggccacaacaagatgcgcatcttccaggag
gagatttttgggccggtggtttcggtcacgaccttcaaggatgacgacgaagccctggcg
attgccaacgatacgctctacggcctcggtgccggcgtctggacacgcgatgccaaccgc
gcctatcgcttcggccgcgcgatccaggctggccgcgtctggaccaactgctaccatgcc
tatcccgcgcatgcggccttcggcggctacaagcagtccggcatcggtcgagagacccac
aagatgatgctcgaccactaccagcagacgaagaacatgctggtcagctacagcccgaag
aagctcggcttcttctga

DBGET integrated database retrieval system