KEGG   Mesorhizobium opportunistum: Mesop_6346Help
Entry
Mesop_6346        CDS       T01542                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mop  Mesorhizobium opportunistum
Pathway
mop00473  D-Alanine metabolism
mop00550  Peptidoglycan biosynthesis
mop01100  Metabolic pathways
mop01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mop00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Mesop_6346
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Mesop_6346
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Mesop_6346
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mop01011]
    Mesop_6346
Enzymes [BR:mop01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Mesop_6346
Peptidoglycan biosynthesis and degradation proteins [BR:mop01011]
 Precursor biosynthesis
  Amino acid ligase
   Mesop_6346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATP-grasp_3 ATP-grasp_4 CPSase_L_D2 TTL RimK GARS_A
Motif
Other DBs
NCBI-ProteinID: AEH90704
UniProt: F7Y511
LinkDB All DBs
Position
complement(6521653..6522675)
Genome map
AA seq 340 aa AA seqDB search
MRVAVVSNHDHTGVINRFGQPIPEFGDREEVESVVAALQEGGHETLICDGDKGLLATLER
FMPPDRQSRPSGIVFNLAWGSQGERPEAGVPAMLEMAGVPCTGPGPLGYGLAFDKVIIKR
LIRDRGVPTPNFRVMRLGTETTGDLRFPLVVKPRYECASFGLQLAHEPAQLRQAVEVIVT
LYAQDALVEEYIDGREITVALLGNRELEVLPLVEYDFRDREKRCLTREAKQRRICPGQIG
SRLATVLQDISVATFLECQCRDYARVDLRIDRSGQAFVLEINNMPSLRMRASYVLAARTA
GYTFSSLVNRILDVAHMRYFGIGIPNAEHASNRGRRIGSS
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtagcagtcgtatcgaaccatgatcatacaggtgtgatcaaccggttcgggcag
cctattccggagttcggcgaccgcgaagaggtggaaagcgtggtggcggcgctgcaagag
ggaggtcacgagacgctgatttgcgacggcgacaaaggactgctcgctacgctcgagcgg
ttcatgccccccgatcggcaatcccggccctcggggatcgtcttcaacttggcgtgggga
agtcagggcgagcgccctgaagccggcgttccggccatgcttgagatggcaggcgtgccg
tgtaccggaccgggcccgcttggatatggtctggcgttcgacaaggtcatcatcaagagg
ctcatccgcgatcgcggagtgccgacgccaaattttcgggtgatgcgtctcggcaccgag
actaccggcgacctgcgattcccattggtagtgaagccgcgttacgaatgcgcgagcttc
gggttacagctggcacatgagcccgctcagttgaggcaggccgtggaggtgatcgtaacg
ctgtatgctcaggacgcactcgtcgaagaatacattgatgggcgagaaatcactgtcgcg
ctgcttggaaatcgagagctcgaggtgttaccccttgtggaatacgacttccgcgaccgc
gaaaagcgttgtctgactcgggaagctaagcagcggagaatttgcccggggcaaatcggg
agtaggcttgcgactgtgctgcaagatatttcggttgcgacgttccttgagtgccagtgc
cgggactacgcccgcgtcgacctacggatcgaccgctccggccaggcctttgtcctcgag
atcaacaacatgccgtcactccgtatgcgcgcctcttatgttctggcagcgaggaccgcc
ggatacaccttctcgagtttggtaaatcgcatccttgatgttgcgcacatgcggtatttc
ggaatcggcatccccaacgccgaacacgcgtcgaatcgcggccggaggatcggaagttcc
tga

DBGET integrated database retrieval system