KEGG   Methylobacterium oryzae: MOC_0153Help
Entry
MOC_0153          CDS       T03299                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
mor  Methylobacterium oryzae
Pathway
mor00010  Glycolysis / Gluconeogenesis
mor00620  Pyruvate metabolism
mor01100  Metabolic pathways
mor01110  Biosynthesis of secondary metabolites
mor01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MOC_0153
   00620 Pyruvate metabolism
    MOC_0153
Enzymes [BR:mor01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     MOC_0153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh YCII
Motif
Other DBs
NCBI-ProteinID: AIQ87908
UniProt: A0A089NQ13
LinkDB All DBs
Position
150550..152073
Genome map
AA seq 507 aa AA seqDB search
MNKPEFLGDAKVKSPFSARYENFIGGQWVAPAAGRYFENTSPITGKVVCEVARSDAQDVE
KALDAAHAAKEAWGRTAPAERARILLKMADRMEENLDLLALAETWDNGKPIRETTHADIP
LAIDHFRYFAGCVRAQEGSISEIDHDTVAYHFHEPLGVVGQIIPWNFPILMAVWKLAPAL
AAGNCVVLKPAEQTPASVLVLAEIIGDLLPPGVLNIVNGFGLEAGKPLASSPRIAKIAFT
GETTTGRLIMQYASQNLIPVTLELGGKSPNIFFADVANEDDDFFDKALEGFTMFALNQGE
VCTCPSRALVHESIYDRFMERAVKRVEAITQGSPLDPATMIGAQASGEQMEKILSYIDIG
KQEGAQLLTGGERNVKEGEFAEGFYVKPTVFRGHNKMRIFQEEIFGPVLSVTTFKDDAEA
LAIANDTLYGLGAGVWTRDGTRAYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRE
THKMMLDHYQQTKNMLVSYSAKKLGFF
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagccggaattcctcggcgacgccaaggtcaagtcgccgttctcggcccgctac
gagaacttcatcggcggccagtgggtcgcccccgcggccggccgctacttcgagaacacc
tccccgatcaccggaaaggtggtgtgcgaggtggcccgctccgacgcacaggacgtcgag
aaggcgctcgacgccgcccacgccgccaaggaggcctggggccgcacggcgccggccgag
cgcgcccgcatcctcctcaagatggccgaccggatggaggagaacctcgatctgctcgcc
ctcgccgagacctgggacaacggcaagccgatccgcgagacgacccacgccgacatcccg
ctggccatcgaccacttccgctatttcgccggctgcgtgcgggcgcaggaaggctcgatc
tccgagatcgaccacgacacggtcgcctaccatttccacgagccgctgggcgtcgtcggc
cagatcatcccgtggaacttcccgatcctgatggcggtgtggaagctcgccccggcgctc
gccgccggcaattgcgtggtcttgaagcccgccgagcagaccccggcctctgtgctggtg
ctggccgagatcatcggcgacctgctgccgccgggcgtgctcaacatcgtcaacggcttc
ggcctggaggccggcaagccgctcgcctcctcgccgcggatcgccaagatcgccttcacg
ggtgagacgaccaccggccgcctcatcatgcagtatgcgtcgcagaacctgatcccggtg
acgctggaactcggtggcaagtcgccgaacatcttcttcgccgacgtggcgaacgaggac
gacgacttcttcgacaaggcgctcgaaggcttcacgatgttcgccctcaaccagggtgag
gtctgcacctgcccgagccgcgcgctcgtgcatgagtcgatctacgaccgcttcatggag
cgggcggtgaagcgcgtcgaggcgatcacgcagggctcgcccctcgatccggccacgatg
atcggcgcccaggcgtcgggcgagcagatggagaagatcctcagctacatcgacatcggc
aagcaggagggcgcccagctgctcaccggcggcgagcgcaacgtcaaggagggcgagttc
gccgagggcttctacgtgaagccgacggtgttccgcggccacaacaagatgcggatcttc
caggaggagatcttcggcccggtcctgtcggtcacgaccttcaaggacgatgccgaggcg
ctcgcgatcgccaacgacacgctctacggcctcggcgccggcgtctggacccgcgacggc
acccgcgcctatcgcttcggccgggcgatccaggccggccgcgtctggacgaactgctac
cacgcctacccggctcacgcggccttcggcggctacaagcagtccggcatcggccgtgag
acccacaagatgatgctcgatcactaccagcagaccaagaacatgctggtcagctactcg
gccaagaagctcggattcttctga

DBGET integrated database retrieval system