KEGG   Methylobacterium oryzae: MOC_0323Help
Entry
MOC_0323          CDS       T03299                                 

Definition
(GenBank) Alpha amylase catalytic region
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
mor  Methylobacterium oryzae
Pathway
mor00500  Starch and sucrose metabolism
mor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mor00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MOC_0323
Enzymes [BR:mor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     MOC_0323
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     MOC_0323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase DUF3459
Motif
Other DBs
NCBI-ProteinID: AIQ88078
UniProt: A0A089NQF6
LinkDB All DBs
Position
330739..332406
Genome map
AA seq 555 aa AA seqDB search
MINDLWYKNAIIYCLSVGTFMDANGDGIGDFAGLERRLDYIQGLGATAVWLMPFQPSPKK
DGGYDIADYYGVDPDYGSLGDFVAFTHAAKQRGLRVLIDLVVNHTSDQHPWFQSARSDPD
SPYRDWYVWSKERPASADEGMVFPGVQETTWTYDAKAKAWYFHRFFNFQPDLNTANPEVL
AEILKIMGFWIQLGVSGFRMDAVPFVIAEKGADVGGKPREQFEMLRDLREFLQWRQGDAI
ILAEANILPNQDMDYFGDDADRMHMMFNFQVNQATFYALAAHDARPLVKAIERTKPRPLS
CQWGIFLRNHDELDLGRLTGKQRQSVFDAFGPEKGMQLYDRGIRRRFAPMLAGDPRRIRL
AYSLMFTLPGTPVLRYGDEIGMGDELALKERDCARTPMQWTSEYQGGFSTADRTVIPLID
HGPYGYAHVNVADQRHEADSLLNWMQSMIRQRKEAPEIGWGDVVPMETGRPSVLALRYDW
RGNAILCVHNLAPEPVEVAMASGVEDPEHDILVDVLTGSRSEVGEDGRHCLFLEGYGYHW
FRVGGLDALLKRRPA
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacgacctgtggtacaagaacgccatcatctattgcctgtcggtcggcaccttc
atggatgccaacggcgacgggatcggcgacttcgctgggctcgagcgccggctcgactac
atccagggcctgggcgccaccgcggtctggctgatgcccttccagccgtcgcccaagaag
gatggcggctacgacatcgccgactattacggcgtcgaccccgattacggctcgctcggt
gacttcgtcgccttcacccacgccgccaagcagcgggggctgcgggtgctgatcgacctc
gtggtcaaccacacctcggaccagcacccatggttccagtcggcccgctccgacccggac
tcgccctatcgcgactggtacgtctggtcgaaagagcgccccgcgagcgccgacgagggc
atggtcttcccgggcgtgcaggagaccacctggacctacgatgcgaaggccaaggcgtgg
tatttccaccgcttcttcaacttccagccggatctcaacacagccaatcccgaggtgctg
gccgagatcctcaagatcatgggtttctggatccagctgggcgtctccggcttccgcatg
gatgccgtgccgttcgtcatcgccgagaagggggccgatgtcggcggcaagccccgcgag
cagttcgagatgctgcgcgacctgcgcgagttcctgcaatggcggcagggcgacgccatc
atcctggccgaggccaacatcctgccgaaccaggacatggattatttcggcgacgacgcc
gaccgcatgcacatgatgttcaacttccaggtcaatcaggcgaccttctacgcccttgcg
gcccatgatgcgcgcccgctggtcaaggcgatcgagcggacgaagccgcgcccgctctcc
tgccaatggggcatcttcctgcgaaaccacgacgagctggacctgggacgcctgacgggc
aagcagcgtcagagcgtgttcgacgccttcgggcccgagaaggggatgcagctctacgac
cgcggcatccgccgccgcttcgcaccgatgctggccggcgatccccgccgcatacggctg
gcctattcgctgatgttcaccctgccggggacgccggtgctgcgttacggcgacgagatc
ggcatgggcgacgagctcgcgctcaaggagcgggactgcgctcgcacgccgatgcagtgg
accagcgagtatcagggcggcttctccacggccgaccgcacggtgattccgctgatcgac
cacgggccctacggctacgcgcacgtgaacgtcgccgaccagcgccacgaggccgactcg
ctgctcaactggatgcagagcatgatccggcagcgcaaggaggcgccggagatcggctgg
ggcgacgtggtcccgatggagaccgggcgtccctcggtgctggcgctccgctacgactgg
cgcggcaacgccatcctgtgtgtccacaatttggcgccggagcccgtcgaggtcgccatg
gcatccggcgtggaggatcccgagcacgacatcctcgtcgatgtgctgaccggcagccgc
agcgaggtcggcgaggacggccggcactgcctgttcctggaaggctacggctaccactgg
ttccgggtcgggggcctcgacgcgctgttgaagcggcggccggcgtga

DBGET integrated database retrieval system