KEGG   Methylobacterium oryzae: MOC_0846Help
Entry
MOC_0846          CDS       T03299                                 

Definition
(GenBank) Shikimate kinase I
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
mor  Methylobacterium oryzae
Pathway
mor00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mor01100  Metabolic pathways
mor01110  Biosynthesis of secondary metabolites
mor01130  Biosynthesis of antibiotics
mor01230  Biosynthesis of amino acids
Module
mor_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:mor00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MOC_0846
Enzymes [BR:mor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     MOC_0846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 Cytidylate_kin2 dNK AAA_22 TsaE Cytidylate_kin APS_kinase CoaE AAA_5 RsgA_GTPase Mg_chelatase AAA_16
Motif
Other DBs
NCBI-ProteinID: AIQ88601
UniProt: A0A089NL41
LinkDB All DBs
Position
848119..848742
Genome map
AA seq 207 aa AA seqDB search
MQESMQEAISEEAAGEPIEARLRRALGLRSIVLVGLMGAGKSTVGRRLASRLGLIFKDAD
IEIEAAAGLTIPDIFAIYGEPSFRDGEERVISRLLRAGPLVLATGGGAYLREATRARIAE
SAVSVWLKADLDVLMRRVRKRGNRPLLQTEDPEATMRDLMAVRHPVYAAADVMVISREVS
HDRVVQDVLEALDAHLSGEGSVPVAAQ
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgcaggagtcgatgcaggaggccataagcgaggaggcggcgggtgaaccgatcgaggcg
cgtctgcgccgcgcgctcggcctgcgctcgatcgtgctcgtcggcctcatgggggcgggc
aagagcaccgtcggccggcgcctggcgagtcgcctcgggctgatcttcaaggatgccgac
atcgagatcgaagcggcggccggcctgacgatccccgacatcttcgccatctatggcgag
ccgagcttccgcgacggcgaggagcgggtgatctcgcggcttctccgggccggcccgctg
gtcctggcgaccggcggcggcgcctaccttcgcgaggcgacgcgcgcccgcatcgccgaa
tccgcggtctcggtgtggctaaaggccgatctggacgtgctgatgcggcgcgtgcgcaag
cgcggcaaccgtccgctgctgcagaccgaggacccggaggcgacgatgcgggacctgatg
gccgtgcgccacccggtctacgccgccgccgacgtgatggtcatctcccgggaggtgtcg
cacgaccgggtcgtccaggacgtgctggaagcgctggacgcccatctcagcggcgaaggc
tccgtccccgttgccgcccagtga

DBGET integrated database retrieval system