KEGG   Methylobacterium oryzae: MOC_2780Help
Entry
MOC_2780          CDS       T03299                                 

Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mor  Methylobacterium oryzae
Pathway
mor00473  D-Alanine metabolism
mor00550  Peptidoglycan biosynthesis
mor01100  Metabolic pathways
mor01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mor00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MOC_2780
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MOC_2780
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    MOC_2780
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mor01011]
    MOC_2780
Enzymes [BR:mor01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     MOC_2780
Peptidoglycan biosynthesis and degradation proteins [BR:mor01011]
 Precursor biosynthesis
  Amino acid ligase
   MOC_2780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 GARS_A
Motif
Other DBs
NCBI-ProteinID: AIQ90535
UniProt: A0A089NVF5
LinkDB All DBs
Position
complement(2813806..2814729)
Genome map
AA seq 307 aa AA seqDB search
MSKHVAVLLGGTSAEREVSLSSGKACADALEGEGYRVTRVDVGPDIASVLTALKPDVAFN
ALHGPDGEDGTIQGLLEILRIPYTHSGVLASALAMNKEQAKTVMRAAGVDVPEGRIVNRR
EAARTHPLPPPYVVKPIAEGSSVGVIIVRDGRSHPPQILASEEWTFGEQVLVEPYIAGRE
LTCGVMGDRALGVIEVKAATGDWYDYDAKYAPGGSVHVLPAELKPNVYQRVQELSLTAHQ
ALGCRGVSRADLRYDDTPGGTGLLVVLEVNTQPGMTQTSLVPEMAAHAGLSFGELVRWMV
EDASLNR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagcacgtcgccgtcctgctgggcggcacctccgccgagcgcgaagtctcgctc
agttccggcaaggcctgcgccgacgccctcgaaggcgagggctaccgggtcacccgggtt
gatgtcggtcccgatatcgcctccgtgctgacggcgctcaagccggacgtggccttcaat
gcgctgcacggcccggacggggaggacggcacgatccagggtctcctggagatcctcagg
atcccctacacccattccggcgtcctcgcctcggcgctcgcgatgaacaaggagcaggcc
aagaccgtcatgcgcgcggccggcgtcgacgtgccggaaggccggatcgttaaccgtcgt
gaggccgccaggacacaccccctgccgccaccctatgtggtgaaacccatcgccgagggc
tcctcggtgggtgtgatcatcgtgcgcgacgggcgctcgcacccgccccagatcctcgcc
tccgaggagtggacgttcggcgagcaagtccttgtagaaccttacatagccggccgcgag
ctcacctgcggggtgatgggcgacagggccctcggcgtgatcgaggtgaaggccgcgacg
ggggattggtacgactacgacgctaaatacgccccgggggggtcggtgcacgtgctcccg
gccgaacttaaaccaaatgtttaccagcgtgtccaagaactgtcgttaacggcgcatcaa
gcactgggctgtcggggcgtcagccgtgccgaccttcgctacgacgacacaccgggtgga
accggtctgctcgtcgtgctggaggtcaacacgcaacccggcatgacccagacgagcctt
gtgccggagatggcggcccatgcgggcctgagtttcggtgagctcgtccgatggatggtg
gaggacgcttccctgaatcgctga

DBGET integrated database retrieval system