KEGG   Methylobacterium oryzae: MOC_4109Help
Entry
MOC_4109          CDS       T03299                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mor  Methylobacterium oryzae
Pathway
mor00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mor00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MOC_4109
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mor02000]
    MOC_4109
Enzymes [BR:mor01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     MOC_4109
Transporters [BR:mor02000]
 Other Transporters
  Pores ion channels [TC:1]
   MOC_4109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: AIQ91864
UniProt: A0A089QBF9
LinkDB All DBs
Position
4118887..4119498
Genome map
AA seq 203 aa AA seqDB search
MSEPLTIYGDPGSGNCLKVKWVAAHLGIPAVWRDVDVPGGGTRTPEFLALNPAGRVPIVV
LPDGAVLSESNAIIVYLAEGSALIPEAALPRARMLQWMFWEQYSHEPYIAVRRYQLHYLK
RAPEDLDPKLAERGADALRLMERTLACSAFLAGEAMTLADVALVAYTRMAHEGGFDLAGY
GAIRAWIGRVEDGLGIGPYAGPA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaccgctgacgatctatggcgacccgggctccgggaactgcctcaaggtcaag
tgggtcgcggcccatctcggcatcccggcggtctggcgcgacgtagatgtcccgggcggc
gggacccgcacgcccgaattcctggccctgaaccccgccgggcgggtgccgatcgtcgtc
ctgcccgacggcgccgtgctgtcggaatcgaacgcgatcatcgtctatctcgcggagggc
tccgcgctgatccctgaagcggccctgccccgtgcccggatgctgcagtggatgttctgg
gagcagtacagccacgagccctacatcgcagtccgccgctaccagctccattacctcaag
cgggcgccggaggatctcgacccgaagctcgccgagcggggcgccgacgccctgcggctg
atggagcggacgctggcctgttccgccttcctggcgggcgaggccatgaccctcgccgat
gtggcgctcgtcgcctacacccgcatggcccatgagggcggcttcgacctcgcgggctac
ggggccatccgcgcctggatcgggcgcgtcgaggacggcctcgggatcggcccctatgcc
gggccggcctga

DBGET integrated database retrieval system