KEGG   Methylobacterium oryzae: MOC_4645Help
Entry
MOC_4645          CDS       T03299                                 

Definition
(GenBank) Glutamine synthetase adenylyltransferase
  KO
K00982  [glutamine synthetase] adenylyltransferase / [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase [EC:2.7.7.42 2.7.7.89]
Organism
mor  Methylobacterium oryzae
Brite
KEGG Orthology (KO) [BR:mor00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MOC_4645
Enzymes [BR:mor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.42  [glutamine synthetase] adenylyltransferase
     MOC_4645
    2.7.7.89  [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase
     MOC_4645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlnE GlnD_UR_UTase
Motif
Other DBs
NCBI-ProteinID: AIQ92400
UniProt: A0A089P0X2
LinkDB All DBs
Position
4643226..4646207
Genome map
AA seq 993 aa AA seqDB search
MRDETGLRNGSATTLRASLSPRLGLADPDAAQARLAEIAPALPAGFLTPPCRDLLLGLAD
HSPFLWRAATRSPDRLVALLEQAPDAASRDIIARQRAVGASCGANPDLGEVGRRLRANRE
EHALLVALADLGGCWDLDAVTQALSAFADASVSGAVEALLRQGMAAGRFRPADPEAPQDG
SGLIVLGLGKLGGCELNYSSDIDLVVFYEAGSAAAATGGDPKPFFVKLAQGLVKLLADRT
ADGYVHRIDYRLRPDPGSTAVALSTGFAFDYYQTLGQNWERAAFIKARPIAGDIPAGEAF
LAELAPFIWRRHFDFPAIAEIHALKRQIHMVRGHETIAVGGHDIKIGRGGIREIEFFVQT
QQLVFGGRKPALRGRRTVAMLAELVAQGWIDGQARDELRAAYTFLRTLEHRIQMIRDEQT
QRLPTGTEALTALALFAGFSDLAAFEAALLHHAGRVQAHYALLFEAGPEAGGDGAPLVFG
ASEPEPATLARLGTFGFRDPPLAWETVQGWHLGRRPALRTGRAREILAEVLPALLRALGG
TADPDAALLALDRAFARMPAVAELLAILRSHERLRLLFADILGTAPRLADTVGLSPHVLD
TVLDADFVTPTTDPDQVRAQYRALLGQPASHEESLDRCRDATRQMTFVTGARLLSGILTP
RQAGEAYAAIADATVALSLEAEERRFALDHGTLPKGRCCILALGRLGSRQLSAESDLDLV
FLYDFDPENRTSDGRRPLDAVVAYNRLAQRVFAALTTATRRGRLYAVDLRLRPYGSHSPP
AVQLSGFAAYHGGEAELWEHMALARARVVAGDATLAADVTAAIARVLRQPRETAAVCAEA
GAMRALVARERGHAGPFDLKLAPGALFDLDFLAQALVLSRARDWPGCIGLGAEALFREAA
ARGLLPAATGEALAETYGFLDAVYQWQRLVMTDPAAEPSETAARQIAKAVGLPDARSLAA
ELRRHRRRSQALLARIRRTLRMPGAADVPPEHG
NT seq 2982 nt NT seq  +upstreamnt  +downstreamnt
atgagagacgagaccggtctccggaacggatcggccacgacgctgcgcgcgagcctgagc
ccccggctcggcctcgccgatccggacgccgcgcaggcccggctcgccgagatcgcgccg
gcccttccggccggtttcctgacgccgccgtgccgggacctgctcctcggcctcgcggac
cactcgcccttcctctggcgggcggccacccggtcgccggaccggctcgtcgccctgctg
gaacaggcgccggacgcggccagccgggacatcatcgcccggcagcgcgcggtcggcgcg
tcctgcggggcgaaccccgacctcggcgaggtcggccggcggctgcgcgccaaccgggag
gaacatgccctcctggtcgcgctggccgatctcggcggctgctgggatctcgacgcggtg
acccaggccctgtcggccttcgcggacgcctcggtgagcggggcggtcgaggcgctgctc
cggcaggggatggcggccgggcggttccggcccgcggatccggaggcgccgcaggacggg
tccggcctgatcgtcctcggcctgggcaagctcggcggctgcgagctgaactattcgagc
gacatcgacctcgtcgtcttctacgaggccggctccgccgccgcggccaccggcggcgat
ccgaagcccttcttcgtcaagctggcgcaggggctggtgaagctcctggccgaccggacc
gcggacggctacgtccaccgcatcgactaccggctgcggccggacccgggctccaccgcg
gtggcgctctccaccggcttcgccttcgactactaccagacgctcggccagaactgggag
cgcgcggccttcatcaaggcccgaccgatcgccggcgacatcccggccggcgaagcgttc
ctcgcggaactggcgccgttcatctggcgccggcacttcgacttcccggccatcgccgag
atccacgctctaaagcggcagatccacatggtccgcggacacgagaccatcgcggtcggc
ggccacgacatcaagatcggccgcggcggcatccgggagatcgagttcttcgttcagacc
cagcagctcgtcttcggcggccgcaagcccgccctgcgggggcggcgtacggtcgcgatg
ctggccgaactcgtcgcgcagggctggatcgacgggcaggcccgggacgagctgcgtgcg
gcctacacgttcctgcgcaccctggagcaccggatccagatgatccgggacgagcagacc
cagcgcctgcccaccgggaccgaggcgctgaccgcgctggcgctgttcgcgggcttttcc
gacctggcggccttcgaggcggcgctgctccaccacgccggccgggtccaggcgcattac
gccctgctgttcgaggccgggccggaggccggcggggacggggcccccctggtcttcggc
gcgagcgagccggagcccgcgaccctggcgcggctcggcaccttcgggttccgggatccg
cccctggcctgggagaccgtgcagggctggcatctcgggcgccgcccggccctgcggacc
ggacgggcccgggagatcctcgccgaggtgctcccggcgctgctgcgggcgctcggcgga
accgccgatccggacgcggcgctcctcgccctcgaccgggccttcgcgcggatgcccgcg
gtggcggaactcctcgccatcctgcgctcgcacgagcgcctgcgcctcctgttcgccgac
atcctggggacggcaccccgcctcgccgacacggtgggcctgagcccgcacgtcctcgac
accgtgctcgacgcagatttcgtgacgccgaccaccgatcccgatcaggtccgcgcgcag
taccgggcgctcctgggacagccggcgagccacgaggagagcctcgaccgctgccgggac
gccacgcggcagatgaccttcgtcaccggcgcccgcctcctgtcgggcatcctcacgccg
cgccaggccggggaggcctacgcggcgatcgccgacgcgacggtggcgctgagcctggag
gcggaggagcgccggttcgccctggaccacggcacgctgcccaagggacgctgctgcatc
ctggcgctgggccgcctcggatcccggcagctcagcgcggaatccgacctcgacctcgtc
ttcctctacgatttcgacccggagaatcgcaccagcgacggccggcgccccctcgacgcc
gtggtggcctacaaccggctggcgcaacgcgtgttcgcggcgctcaccacggccacgcgg
cgggggcggctctacgcggtcgacctgcggctgcggccctacggcagccacagcccgccc
gccgtgcagctcagcggcttcgcggcctatcacggcggcgaggcggaactctgggagcac
atggcgctcgcccgcgcccgggtcgtggccggcgacgccaccctggcggccgacgtcacg
gccgcgatcgcccgggtgctccggcaaccgcgcgaaaccgccgccgtctgcgccgaggcg
ggcgcgatgcgggccctggtcgcccgggagcggggccatgccggccccttcgacctgaag
ctcgcaccgggcgcgctgttcgacctcgacttcctggcccaggccctcgtgctgagccgg
gcccgcgactggcccggctgcatcggcctcggcgcggaggcgctgttccgggaggcggcg
gcgcgcggcctcctgcccgcggcaacgggcgaggccctcgccgagacctacgggttcctc
gacgccgtctatcagtggcagcgactcgtgatgaccgatcccgccgcggagccctccgag
accgcggcccggcagatcgccaaggccgtgggccttccggacgcccgcagcctcgcggcg
gagctgcgccgccaccggcgccggagccaggccctgctggcgcggatccggcggactttg
cggatgccgggcgccgcggatgtcccgccggagcacggctga

DBGET integrated database retrieval system