KEGG   Moraxella osloensis: AXE82_04540Help
Entry
AXE82_04540       CDS       T04294                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
mos  Moraxella osloensis
Pathway
mos00970  Aminoacyl-tRNA biosynthesis
mos01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mos00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AXE82_04540
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mos03029]
    AXE82_04540
Enzymes [BR:mos01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AXE82_04540
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AXE82_04540
Mitochondrial biogenesis [BR:mos03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AXE82_04540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AME01130
UniProt: A0A378Q7M8
LinkDB All DBs
Position
1021711..1023207
Genome map
AA seq 498 aa AA seqDB search
MSELHTFSVAQLAAGLKNKDFSSTELTKHFLNRIAQHDKAINSFITVTPEQALAQAAAAD
KLLAEGKGADLTGVPLAHKDIFCTQGVLTTCGSKMLENFVAPYNATIVENCQNAGLVMLG
KTSMDEFAMGSDNESSYFGAVHNPWDVSRVPGGSSGGSAAAVAAGFAPFATGSDTGGSIR
QPASFCGLTGIKPTYGRVSRYGMVAYASSFDQAGSFGKTAEDCAYLLSVLSGHDSKDSTS
ANKEVPDFVASLTSKRQANASHDKPLQGLRIGVPSEYFADGLNSEVKASVEAALKQYQAL
GASLVDVNLTKPEITLATYYLLAPAEASSNLSRYDGVRYGYRCDSPKNLEDLYTRSRSEG
FGAEVQRRILMGTYALSAGYFDAYYIKAQKVRRLISQDFAKAFESCDVIATPTAPTTAYK
IGASLSPAEIYMGDVYTIGVNLAGLPSLSHPVGFDGDNLPVGLQLIAKAWDEETLLQTAD
AYQQVTDFHQQLSPIAKA
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaactacatacgttttcggttgcccaattggcagcaggtctaaaaaataaagac
tttagcagtaccgaacttaccaagcactttctcaatcggattgcccagcatgataaagcc
attaacagctttatcacagtcacgcctgaacaagcgttagcgcaagctgccgccgccgat
aaattattggcagaaggcaaaggcgcagacttgacgggcgtgccactggctcataaagac
attttttgtacccaaggcgttttaaccacttgtggctcaaaaatgctagaaaactttgtg
gcgccttacaacgctactatcgttgaaaactgccaaaatgcaggcttagttatgcttggc
aaaaccagcatggatgagttcgcgatgggctcggacaatgagtcatcatactttggcgcc
gtgcacaacccctgggatgtcagccgcgtaccaggcggttcatcgggtgggagcgcggca
gcggttgcggcaggttttgcgccctttgccacaggctcagataccggcggctcgattcgt
caacctgcgtcattttgtggtttgacagggattaagccaacttacggacgtgtctcacgt
tatgggatggtggcgtatgcgtcaagttttgaccaagctggcagttttggtaaaaccgca
gaggattgtgcttatttgctgagcgtgttatcaggtcatgacagcaaagactcaacgtct
gccaacaaagaggtgcccgattttgtcgctagtttgaccagcaaacgccaagccaatgcc
agccatgataaaccgcttcaagggttacgcatcggggttccatctgaatactttgccgat
ggcttaaatagcgaagttaaagccagcgtagaagcggcattaaaacaataccaagccttg
ggtgcaagcttggtggatgtgaatttgaccaaacctgaaatcacccttgccacttattat
ttgctcgccccagccgaggcttcatctaacttatcgcgttatgatggggtgcgttatggc
taccgctgtgacagcccaaaaaacttagaagatttatacacccgctcacgttctgaaggc
tttggtgctgaagtacagcgccgtattttgatgggtacctatgcgttatcagcgggttat
tttgatgcctattatatcaaagcgcaaaaagtgcgccgcctcatcagccaagactttgcc
aaagcctttgaaagctgtgatgtcattgccacaccaactgcgccaacgacggcttataaa
atcggtgcaagccttagccctgccgaaatttatatgggggatgtttataccattggcgtg
aatttagccggtttaccgtcattaagccatccggtgggttttgatggtgacaatctgcct
gtcggcttacagctgattgcaaaggcatgggacgaagagacgctactgcagactgccgat
gcgtatcagcaagtcactgattttcaccaacaactatcacccatcgccaaagcctaa

DBGET integrated database retrieval system