KEGG   Moraxella osloensis: AXE82_08530Help
Entry
AXE82_08530       CDS       T04294                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mos  Moraxella osloensis
Pathway
mos00473  D-Alanine metabolism
mos00550  Peptidoglycan biosynthesis
mos01100  Metabolic pathways
mos01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mos00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AXE82_08530
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AXE82_08530
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AXE82_08530
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mos01011]
    AXE82_08530
Enzymes [BR:mos01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AXE82_08530
Peptidoglycan biosynthesis and degradation proteins [BR:mos01011]
 Precursor biosynthesis
  Amino acid ligase
   AXE82_08530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp CPSase_L_D2 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AME01796
UniProt: A0A378QBW7
LinkDB All DBs
Position
1938824..1939747
Genome map
AA seq 307 aa AA seqDB search
MSELIDVKQFGKVAVVCGGWSAEREVSLTSGQAVLDALLTKGVDAHHFDPKETDISKLRD
YDRVFNVLHGTFGEDGSLQGVLDGFNIPYTGCGVLASAIAMDKFRNRLVWQALDLPNVPY
VVLDDNTDFTAIEQQLGLPLFVKPAAEGSSVGVFKIKQAGELAKTYPQLKQYHGAILAEK
AITGGEYACSILGDEVLPSIRIIPTTEFYDYEAKYNRDDTVYQCPSDLSEAQEHTMQQIA
RKAFAALGGKGWSRVDFLRDDEGTLYLLELNTVPGMTSHSLVPMAAKARGMDFATLCVRI
LEQTLSD
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagcttatcgatgtcaaacaatttggtaaagtggcggttgtctgtggcggctgg
agtgccgagcgtgaagtatcgctgaccagtggtcaagctgtgcttgatgcgctactcact
aaaggcgtggatgcccatcactttgaccccaaagaaacagatatctcaaaactgcgcgac
tatgaccgcgtatttaatgtgctgcatggcacttttggcgaagatggcagcctgcaaggg
gtgctagacggttttaatattccgtataccggttgtggcgtattagcctctgcaattgcc
atggataagtttcgcaaccggctagtttggcaagcgttagatttaccaaacgtaccttat
gtcgtgcttgatgacaataccgattttactgctatcgaacagcagctaggtttaccgctg
tttgtcaaacccgccgctgaaggcagtagtgtcggcgtatttaaaattaaacaagcgggc
gagcttgccaagacctacccacagctcaaacaataccacggcgctattctggcagaaaaa
gccatcacaggcggtgagtatgcttgctctatcctcggtgatgaggtactgcccagtatt
cgcatcatcccaacgaccgagttttatgactacgaagccaaatacaatcgtgatgatacc
gtctaccaatgcccatcagatttgagtgaggcgcaagaacacaccatgcagcaaatcgca
agaaaagcgtttgccgcccttgggggcaaaggttggtcacgtgtggattttttacgagat
gacgaaggcacgctatatctgcttgaactcaatacggtgcccgggatgaccagtcatagt
ctggtgccgatggcagcaaaagcgcgtggcatggattttgcgacgctatgcgtgcgtatc
ttagaacaaacgttgagcgactaa

DBGET integrated database retrieval system