KEGG   Moraxella osloensis: AXE82_08930Help
Entry
AXE82_08930       CDS       T04294                                 

Definition
(GenBank) anthranilate synthase
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
mos  Moraxella osloensis
Pathway
mos00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mos01100  Metabolic pathways
mos01110  Biosynthesis of secondary metabolites
mos01130  Biosynthesis of antibiotics
mos01230  Biosynthesis of amino acids
mos02024  Quorum sensing
Module
mos_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mos00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AXE82_08930
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    AXE82_08930
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AXE82_08930
Enzymes [BR:mos01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     AXE82_08930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N DUF1869 Peptidase_A4
Motif
Other DBs
NCBI-ProteinID: AME01866
LinkDB All DBs
Position
complement(2023881..2025290)
Genome map
AA seq 469 aa AA seqDB search
MTTHAKPPKIALASKPSLIKLAQDIDFFELFKRIEAKYATCFLLESLGEESYISRHHAIG
FDPAMTVLAKDRHTLTITNNRTGESTDYTCDNPYQLLREITPQHVISRSHTGGLVGFLGF
DSVNFFEPTLNIQTSDDFEPFKFGVYLDGLSLDKMTGEIFYYYYDTDHQSNRIDEIKSLL
NAISPDYTQPTAEHLGDGMNREQHAAAVMKVKEDIKAGLIFQCEVGFKSHYRIQGDTMPI
YSKLREVNPSPHMYYVKFGAQKIIGASPELLFRLRNGEMETFPLAGTTKRGKDETEDRQL
ARALLNDRKEIAEHNMLVDLHRNDIGRVARFGTVKVRNLMDIKRFSHVQHISSEIVGILD
PNHDMFTALASNFPAGTLSGAPKIEAMKIINTLEPDGRGAYGGALGQFCFNGDCIFAIPI
RSLFINGEKAYAQTCGGNVYDSNPEDEYEEIVRKLSAMKVVLSNFAPVS
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgactacacacgccaaaccgcccaaaatcgcccttgccagcaaaccaagcctgattaaa
cttgcacaagacattgatttttttgaactctttaaacgcatcgaagccaaatacgctact
tgttttttactggaatcgttgggcgaagaaagctatatttcacgtcatcatgccatcggc
tttgaccctgcgatgacagtgttggcaaaagaccgccatactttgactatcaccaacaat
cgcacgggggaaagcacggattatacctgtgacaatccttaccaactactgcgcgaaatc
accccacagcatgtgatttcacgtagccataccggcggattggtcggttttttgggattt
gatagtgtcaatttttttgagccgaccctgaatattcaaaccagtgatgatttcgagccg
ttcaaattcggggtgtacttagatgggttaagccttgataagatgaccggtgaaattttt
tattattattacgataccgaccaccaaagcaatcgtattgacgaaatcaagtcattattg
aatgctatttcgcctgactatacgcagccgactgctgagcacttgggcgatgggatgaac
cgcgagcaacatgcggcagcggtgatgaaagtcaaagaagacattaaagctgggctgatt
ttccagtgtgaagtgggtttcaagtcgcattatcgcatccaaggcgatactatgccaatt
tatagtaaactgcgcgaagtcaacccgtcaccgcatatgtactatgtcaaatttggcgcc
caaaaaatcatcggcgcatcgcctgagttgttgttccgattgcgcaatggtgagatggag
accttcccactggcgggcaccaccaagcgcggcaaggatgagaccgaagatcgccaatta
gcgcgcgccttgctcaatgaccgcaaagaaatcgccgaacataatatgttggtggactta
catcgtaatgatatcgggcgggtggcacgctttgggacggtaaaagtgcgtaacttaatg
gatatcaagcgcttttcacatgtccagcacatctccagtgaaatcgtcggtattcttgac
cctaatcatgatatgttcaccgcgcttgccagtaattttcccgcaggtacgctatcaggc
gcacccaaaattgaagcaatgaaaattataaatacactagagcccgatggccgcggcgct
tacggtggcgcactcggtcagttttgttttaatggggattgtatttttgctattccgatt
cgctcgctgtttatcaatggcgaaaaagcgtatgcgcaaacttgcggtggcaatgtgtat
gactccaatcctgaagatgagtatgaagaaattgtgcgaaaactgtctgcgatgaaagtt
gtactgtccaattttgcgccagtgtcgtaa

DBGET integrated database retrieval system