KEGG   Moraxella osloensis: AXE82_10565Help
Entry
AXE82_10565       CDS       T04294                                 

Definition
(GenBank) hypothetical protein
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
mos  Moraxella osloensis
Pathway
mos02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mos00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AXE82_10565
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mos02000]
    AXE82_10565
Transporters [BR:mos02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    AXE82_10565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_16 AAA_29 RNA_helicase Zeta_toxin NACHT Rad17 AAA_22 RsgA_GTPase AAA_30 AAA_18 AAA_7 MMR_HSR1 SbcCD_C NTPase_1 KAP_NTPase APS_kinase AAA_25 FtsK_SpoIIIE Sigma54_activat DUF87 AAA_33 AAA_23
Motif
Other DBs
NCBI-ProteinID: AME02139
UniProt: A0A378QEV5
LinkDB All DBs
Position
complement(2377911..2379722)
Genome map
AA seq 603 aa AA seqDB search
MTDSTSEKNSENKLASENRLINQNSRVNTHRQKKSNSHQTFRLTQLFSTQLDKWLIAACL
AMMTALSVIGLLMTSGWFISAAAMTGMVALGSHSFNYLVPAAIIRVMAMVRTAGRYGEMM
VSHHAVFGLLQRLRVRFFNQFSRLPLANLSITLQSTHAMHRLTHDIDVLNELPLRVVSPW
LVATTASLLVATLLYQYEVSPVLIAIFLIAGLMLPTMLTWRSIKHARAHQALAESRRVSL
LNPLSALTHLLIWQRWQSELTAFNSVDTQHTHQQKRIQRAQSLVMLIMQWLIAAVLVGLL
VGFYHTPLVISVPMLLALSLGIMGMTDLLTPLVTHSLALGNSLAAKHQLNELLNPSLQPS
HHLTPDLTNHLNHDLAPLPIDVARLSAPLTLTIHQLAAKMPQAIVGFKAISLTATQGIPV
LITGRSGAGKSTLLQVLARELAPQQGSIELNGRDWLALHDTPALTGYLGQQIDIFDQTLA
TNLRLGNADASDEQLWQVLGKVGLKDWARSQPLQLQTPLGEYGQAISGGQARRIALARLL
LSPKKILLLDEPFAGLDKKSREALWQMLVQHQQQGILIIVTHHLWQTDHPINIVQLPEPD
ILI
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgacagactctactagtgaaaaaaatagcgaaaataaacttgctagtgaaaataggctt
attaatcaaaatagccgtgtcaacactcaccggcaaaaaaaatcaaacagtcatcaaacc
tttcgtttaacccagctgtttagcacgcagctagataaatggctcattgctgcctgttta
gccatgatgactgcgttatccgtgattggcctattgatgacgtcagggtggtttatttct
gcggcagcaatgacagggatggtggcgctgggctcacacagttttaattatctggtaccg
gcagcgattatccgtgtgatggcgatggtacgtaccgcaggacgctatggtgaaatgatg
gtgtcccaccatgcggtgtttggtttgttgcagcggctgcgagtgcgtttttttaaccag
ttttcacgcctgccactggcaaatttatcaattaccttacaatctacccatgccatgcac
cgtttaacccatgatattgatgtgctcaatgagttgccactgcgcgtggtatcgccttgg
ctagtcgcgacaaccgcgagcttgctagtagccaccttactttatcagtatgaggttagc
cccgtcttgattgccatatttttaatcgccggtttgatgttgcctaccatgctgacatgg
cgcagtatcaagcacgcccgcgctcatcaggcattggcagagtctaggcgtgtcagtttg
ctcaatccgctatcggcgcttacccatttattgatttggcagcgctggcaatccgaattg
actgcttttaacagcgtcgacactcaacatacgcatcagcaaaagcgcatccagcgcgcc
caatcattggtcatgctaatcatgcagtggctgattgcagcggttttggtcggcttgtta
gtgggtttttatcacacgccccttgtcatcagtgtgccgatgttgcttgcgctatccctc
ggtatcatgggcatgactgacttgctaacaccgttagtcacccattcgctagcccttggc
aatagtttggcagcaaaacaccaactcaatgaattactcaatccttcgctacaacctagc
catcatttaacgcctgatttaaccaatcacttaaaccatgatttagcccctttacccatc
gatgttgcgcgcctaagtgcaccactcacactcaccatccatcagctagctgccaaaatg
ccgcaggcgattgtcggtttcaaagctatcagcttgactgccacccaaggcatccctgta
ttgattactgggcgctcgggcgcgggcaaatcaacactgttacaagtgctggctcgtgaa
ctagcaccgcaacaaggcagcatagagctcaatggtagggattggctagcgttacacgat
acgcccgcgctcacaggttatttggggcaacagattgatatttttgaccagaccttggcg
accaatttaagattgggcaacgccgatgccagtgatgaacagctttggcaagtgctgggt
aaggttggactcaaagactgggcgcgcagtcagccgctacaattacagaccccgctaggg
gaatacgggcaagctatttccggtggacaagccagacgcattgccttggcacggctatta
cttagcccaaaaaaaatcttgctgctagatgagccgtttgcgggacttgataaaaaaagc
cgtgaagcactgtggcaaatgctggtacagcatcagcagcaaggcattttaatcattgtc
acccaccatctttggcaaactgaccatccaattaatatcgtgcaattacctgagcctgat
attttaatttaa

DBGET integrated database retrieval system