KEGG   Mycoplasma ovis: OVS_01305Help
Entry
OVS_01305         CDS       T02962                                 

Definition
(GenBank) hypothetical protein
Organism
mov  Mycoplasma ovis
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AHC40192
UniProt: V9R8P8
LinkDB All DBs
Position
complement(209394..213116)
Genome map
AA seq 1240 aa AA seqDB search
MLSLFTIKKILFFGTLGGGILGPIIATSPIVREFAWSSDISPLKEGITNWNLVDIYEGES
IPSFFKRVLMYKEGQEGLVESFSQELSKQWYFSQPEIWTSHQREEWKKLQEKQFKDAWEH
LKPKNPQRDFWDNYWGSRESMLSFWLRHNSHKLVKSFLTEVDKNDFSLNSSFQKNQEYKN
GNLSGLFTNNSSNTDELEKKTTDWEKIGFFPSKSALKLQDNKWEKFIWGKYQFLNWSYRK
WFDTNLPTYFWKISWFYDKKSNAKKLEGKYKKDQLKNNFPNKANYFFPIFSEKTNKKFQE
FIKKIANDGAPNGGGGGQDLKLEEYFVEGWNGEQASTSTLLDILNSFGNVSPEYASAASY
LTSKIFETNGNGAVGGNSPINKLELKKEKEGNGNPKDPTEVFLSENGTGGKDSNNHSISF
ESEILVESEAQKKKHIYDARETNSNWLFFRDEQGVHALALDGHKYLKQGQPQPASNENNA
KDKLFNWFNFRNLQSKGVSKNWSTNKKFLSLTEKEDWFTRFFNYLTSNFDWLLSEYYIKE
GDKSLLFDELKNKSYFDNFKDSLSQIFSLRGNDELNSKLFNLRKNIIERYSSRDWTTSGN
NGAKEIKVAKEQGLAAPFPYEINLDDKKDGRFPKQEKVFNEFLKQASSASLVAVKGSAPP
SPPTYQESEYSKIFATYFQSVNTLIDDKKIDLKIRSDGFDFQNSQRLFVVDSIFDYLLDK
LFANKGLLNHRVKEKRLLEGSLFSGNGLLQESKGTSEEKLPWVAPINYENKINEILKTGF
TLTAGGGAPPATTSTAWECKGVMFDQEKIKENLRSLLNSLLKSYFFRTYLRGLKDNYFGF
LADYPEGKPKTTQDGVQVSGGTTRFSFLVNDLFEKWRQSYLADVRERDKFLDFLISLNFL
TKKNFEKLKEILRGDMSSNTKYHYLFFESVSGNEEQKKQEQQSHTDGIHPFLSNGKKEDN
NKISFENRSKARTYIRENWKPKGELKNMNGGSSSSGAESSAPGGKNEAMFKELLIEQTGL
PNKKENLFNFKDLRGLLTAINNTTNYSDFEKIVSLLSKISGTNVNVDFYRSDKIYITNSK
EKKIYLEEKKKLLIYQLLHTDKNNFYSSNTFETSVENDIFKQTFEKFVGELTTTPTVVSV
SAPANGNVKNHLKADHFKRGMEKTEGGYFIQVSYQDFESDVSLCAFFNLLPMELLSEFIM
DQADKPLNKEKAQSDFFEAIRKLKPRDMKFKNHIDSKYIE
NT seq 3723 nt NT seq  +upstreamnt  +downstreamnt
atgctatctcttttcacgatcaaaaagattttattttttggaaccttggggggtggaatc
ctcggtccaattattgcaacttctccaatagttagagaatttgcttgaagttcagatatc
tccccactaaaggagggaattactaactgaaatcttgtagatatatatgaaggggagagc
attccctccttctttaaaagagtcttgatgtacaaggaaggacaagaaggtttagttgaa
tctttctctcaagaactttcaaaacaatgatatttctctcagcccgaaatttgaacttct
catcaacgagaagaatggaaaaaattacaagaaaaacaatttaaagatgcatgagaacat
ctaaaacccaaaaatcctcaaagagatttttgagataactattgagggtcaagggaaagc
atgctttctttttgactaagacacaatagtcataaattagttaagtcttttcttacagaa
gtggacaaaaatgatttttctctaaatagttctttccaaaaaaatcaagaatataaaaat
ggaaatttatctggtttatttactaacaattcttcgaacactgatgagctggagaaaaaa
acaacagattgagaaaaaattggattctttccctctaaatctgcattaaagttgcaggac
aataaatgagagaaatttatttgaggaaaatatcaatttctaaattgaagttacagaaaa
tgatttgatacaaatcttcctacatatttttgaaaaattagttgattctatgacaaaaaa
tcaaatgccaaaaaattagaagggaaatataaaaaagaccaattaaaaaataatttccct
aacaaagctaattatttctttcctattttttctgaaaagacaaataagaaatttcaggag
tttattaagaaaattgctaatgatggagcacctaatggaggtggtggtggtcaagattta
aagctagaagaatattttgttgaaggttgaaatggagagcaagcctccacatccactcta
cttgatattcttaattcttttggcaacgtctctccagaatatgcatcagccgcttcctat
ctaaccagcaaaatatttgaaactaatggaaatggggctgtcgggggcaattctccaatc
aacaaacttgaattaaaaaaggaaaaagaaggaaatgggaatcctaaagatcccactgaa
gtatttctttcagaaaatggcacagggggaaaagactccaataatcattcaatttctttt
gaatctgaaattctagttgagtcagaggcacaaaagaaaaaacacatatatgacgcaaga
gaaaccaattctaattgactattcttcagagatgaacaaggagtgcatgccttggcttta
gatggacataagtatttaaaacaaggtcaaccacaacccgcaagtaatgaaaataatgca
aaagataaattattcaattgattcaatttcagaaatcttcaatctaagggagtaagtaag
aattgatctactaataaaaagtttctttctttaacggaaaaagaagattgatttactaga
tttttcaattatttaactagtaactttgattgattattatccgaatactacatcaaagaa
ggagacaaaagtctcttatttgatgagttgaaaaataaaagttattttgataatttcaaa
gattcattgagtcaaatattttctttaaggggtaacgatgaattgaattccaaactcttt
aacttaagaaagaacattattgaaagatatagttctagagattggactactagtggcaat
aatggcgcaaaagagattaaggtggcgaaagaacaaggattggccgctccttttccctat
gagatcaacctagatgacaaaaaagatggaagattcccgaaacaagaaaaagtatttaat
gaatttttaaaacaggcaagtagtgcctctcttgttgcagttaaaggaagtgcgccaccc
tcacctccaacataccaagaatctgaatattcgaaaatatttgcaacttattttcagtcc
gttaacacattaatagatgacaaaaaaattgacttaaagattagatctgatggttttgat
tttcaaaatagtcaaagattattcgttgttgattcaatttttgactatttattagacaag
ttatttgctaataaaggtttattgaatcacagagtcaaagaaaaaagattattagaaggt
agtttatttagtggtaatggtttattgcaagaaagtaaaggtacctcggaagagaaactt
ccatgagttgcgcccattaactatgagaacaagattaatgaaattctaaaaactggattt
acattaactgccggagggggagctcctccggctacaacatcaacagcctgagaatgtaaa
ggggttatgtttgatcaggaaaaaattaaagaaaatcttagatctttgctaaattccctc
ttaaaaagttatttcttcagaacttatttaagaggtcttaaagataattattttggtttt
cttgctgactaccctgaagggaagcctaaaacaactcaagatggagtgcaagttagtggg
ggaactacaagattttctttcttagtaaatgatttatttgaaaaatgaagacagtcttac
ctagcggatgtaagggaaagagataaatttttagattttttaatttctcttaatttcctt
actaagaagaactttgaaaaactaaaggagattttgaggggagacatgtcttcaaacact
aagtatcactatttattctttgaatctgtttctggcaatgaagaacaaaagaaacaagag
caacaaagtcatacagatgggattcatcctttcttaagtaacggaaaaaaagaagacaat
aataaaatttcctttgagaatcgttctaaggctagaacatatatccgagaaaactgaaag
cctaagggggaattaaaaaatatgaatggaggttccagtagtagtggagctgaatcatcc
gcccctggcggtaaaaacgaggctatgtttaaagaattattaattgaacaaaccggatta
ccaaataaaaaagaaaatctttttaatttcaaagatcttcgaggattattgacagcaatc
aataacactacaaattattcagattttgaaaaaattgtctcacttctatctaaaatatca
ggaacaaatgtaaatgttgatttttacagatctgacaagatatacatcacaaatagtaaa
gaaaaaaagatatatctagaagaaaaaaagaaattattaatttatcagttgttacatact
gataaaaataatttttatagttctaatacttttgaaacaagtgtagaaaacgatatcttt
aaacaaacatttgaaaaattcgttggtgaattaacaacaacacctacagttgtttcagtt
tccgctccagctaatgggaatgttaaaaatcacttaaaagcagaccatttcaagagagga
atggaaaaaactgaagggggttatttcattcaagtttcttaccaagactttgaaagtgat
gtaagtctttgtgctttcttcaatttacttccaatggaattattgtctgaattcataatg
gatcaagcagataaacctttaaataaagaaaaagctcaaagtgacttctttgaagcaata
cgtaagttaaagccaagagacatgaaattcaaaaatcatatagattcaaaatatatagag
tag

DBGET integrated database retrieval system