KEGG   Candidatus Methylomirabilis oxyfera: DAMO_0510
Entry
DAMO_0510         CDS       T02155                                 

Definition
(GenBank) 30S ribosomal protein S6 (modular protein)
  KO
K02990  small subunit ribosomal protein S6
Organism
mox  Candidatus Methylomirabilis oxyfera
Pathway
mox03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mox00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    DAMO_0510
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mox03011]
    DAMO_0510
   03029 Mitochondrial biogenesis [BR:mox03029]
    DAMO_0510
Ribosome [BR:mox03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    DAMO_0510
  Bacteria
    DAMO_0510
Mitochondrial biogenesis [BR:mox03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    DAMO_0510
SSDB
Motif
Pfam: Ribosomal_S6
Other DBs
NCBI-ProteinID: CBE67586
UniProt: D5MK03
LinkDB
Position
446849..447229
AA seq 126 aa
MGHYEVIIILDPALTEESIDTEIGGVREVVTKKGGQMLEIQKWGKKRLAYEVKKRREGQY
VLMKVDGPGGVVADLDRHFRITEVILKGAVVRAEEPRRGRFKAKSHATLEGSAVTTTQEM
EDGELQ
NT seq 381 nt   +upstreamnt  +downstreamnt
gtgggtcactatgaggtcattattattttggatccggcccttacggaggagagtattgat
acggagatcggcggagttcgcgaggttgtgaccaagaagggcggacagatgctggagatc
cagaagtggggaaaaaagcgactggcctacgaggtaaaaaagcgacgggaaggtcagtat
gttctcatgaaggtggacggccctggcggagttgtggccgatctcgatcggcattttcgg
atcactgaggtcatcctgaaaggggcggttgtcagggctgaggagcccaggagaggacga
tttaaagcgaagtcgcacgccacactcgagggtagtgccgtcaccactacccaggagatg
gaagatggtgagcttcaataa

DBGET integrated database retrieval system