KEGG   Candidatus Methylomirabilis oxyfera: DAMO_0811
Entry
DAMO_0811         CDS       T02155                                 

Gene name
gatC
Definition
(GenBank) Glutamyl-tRNA(Gln) amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
mox  Candidatus Methylomirabilis oxyfera
Pathway
mox00970  Aminoacyl-tRNA biosynthesis
mox01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mox00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DAMO_0811 (gatC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mox03029]
    DAMO_0811 (gatC)
Enzymes [BR:mox01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     DAMO_0811 (gatC)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     DAMO_0811 (gatC)
Mitochondrial biogenesis [BR:mox03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    DAMO_0811 (gatC)
SSDB
Motif
Pfam: Glu-tRNAGln
Other DBs
NCBI-ProteinID: CBE67874
UniProt: D5MLK8
LinkDB
Position
complement(685122..685412)
AA seq 96 aa
MKITVEEVEHVARLARLELTADEKERMRAQLDSILSYIDKLNELDTSAVEPTSHVLPMTN
VFREDEVTPSLAQEAVLANAPDRHDLFFRVPRILEE
NT seq 291 nt   +upstreamnt  +downstreamnt
atgaagattacggtggaagaggtcgaacatgtggcccggctggcccggctggagctgacc
gcggatgagaaggagcggatgcgggcccagctcgactcgatcctgagctatatcgacaag
ctgaatgagctggacacgtcggccgtcgagccgacctcccatgtcctgccgatgacgaac
gtcttccgcgaggatgaggtcacgccttcgcttgcccaggaggcggtcctggccaatgcg
ccggatcgccacgacctcttcttccgggtcccgagaatcctggaggagtaa

DBGET integrated database retrieval system