KEGG   Candidatus Methylomirabilis oxyfera: DAMO_1508
Entry
DAMO_1508         CDS       T02155                                 

Gene name
argS
Definition
(GenBank) arginyl-tRNA synthetase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
mox  Candidatus Methylomirabilis oxyfera
Pathway
mox00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mox00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DAMO_1508 (argS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mox01007]
    DAMO_1508 (argS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mox03016]
    DAMO_1508 (argS)
   03029 Mitochondrial biogenesis [BR:mox03029]
    DAMO_1508 (argS)
Enzymes [BR:mox01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     DAMO_1508 (argS)
Amino acid related enzymes [BR:mox01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   DAMO_1508 (argS)
Transfer RNA biogenesis [BR:mox03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    DAMO_1508 (argS)
 Prokaryotic type
   Other AARSs
    DAMO_1508 (argS)
Mitochondrial biogenesis [BR:mox03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    DAMO_1508 (argS)
SSDB
Motif
Pfam: DALR_1 tRNA-synt_1d Arg_tRNA_synt_N tRNA-synt_1g tRNA-synt_1e
Other DBs
NCBI-ProteinID: CBE68568
UniProt: D5MFN7
LinkDB
Position
complement(1274545..1276218)
AA seq 557 aa
MIGALKTRLTEALLTTIKQSGFEAGLPQGASTPMTWEYPSDPVFGDLSTTLAFGLAKALR
QRPRDIAMQIAASAAFPSDLVDRVEVAGAGYLNFFIARPFWRHLAQEILRAGPTYGRADV
GGGRPVLVEFVSANPTGPLVVVNARAAAIGDAIARLLEAIGHRPYREYYVNDAGNQFRTL
ALAMEVRCRQLQGEDCPMPEEAYPGEYLIDLAREFLDQHGPEVLSAPEPERRDRLGRFAV
ERIIEWQRASLEAYGVTFDGWFSERNLRERGDTTQVIEALKARSFLYEQDGAVWFRSTLF
GDDKDRVLVKGDGEITYFLPDIAYHQDKFARGFAQVIDLWGPDHHGYVPRMQAAMQALGH
PPGALKILIVQLVRLMRGTEQVRMSKRAGQFVTMGELVDEVGRDAARYTFLTRRCDSQLD
FDLELVKSASEENPVYYVQYAHTRLCGILREATRAQLPVPSPEDNLDRLDLPEEIGLIKQ
LALYPELVIGAAQALEPHRLTTYLHDLAAQFHGYYARHRIISADTNLTRARLTLVAALRV
VMANTLGLLGVSAPERM
NT seq 1674 nt   +upstreamnt  +downstreamnt
atgatcggtgcacttaagacgcgcctgactgaggcgcttctcacgactatcaagcagtcg
ggattcgaagccggactcccgcagggcgcttccacgccgatgacgtgggaatatccgagt
gacccggttttcggcgacctctcaactacgctggccttcggtctggcgaaagcgctgcgg
cagaggccccgcgacatcgcgatgcagattgccgcctcagcagcctttccgtctgatctg
gtcgatcgcgtcgaggtggcgggcgccggctatctgaacttctttatcgcccggccgttc
tggcgtcatctggctcaggagattctgcgagccgggccgacgtacggaagggctgatgtc
ggcggcgggcgtccggtgctggtggagtttgtcagcgcgaatccgaccggcccgctcgtc
gtggtcaatgccagggctgcggccatcggtgatgccatcgctcggctcttagaggctatt
ggacatcggccgtaccgtgagtactatgtgaacgatgcggggaaccaattccgcaccctt
gcgttggcgatggaggtacgatgccgtcaactgcagggtgaggactgcccgatgccggaa
gaggcctatccgggagagtatctgatcgatctggcccgcgagtttctggatcagcacggg
ccggaggtgctctccgcgccggagcccgaacgtcgcgaccgactgggtcgctttgcggtc
gagcggatcattgagtggcagcgggcctcactcgaggcgtacggggtcacctttgacggg
tggttcagcgaacgcaatctccgagagcgcggcgacacgacgcaggtgatcgaggcgttg
aaggcgcgcagtttcctgtatgagcaggatggggccgtctggtttcgttccaccctcttt
ggcgacgacaaagatcgagtcctcgtaaagggtgatggcgagatcacctattttcttccc
gacatcgcctatcaccaggataagtttgcccgcggcttcgcgcaggtgatcgatctttgg
ggacccgaccaccacggctatgtgcctcggatgcaggctgccatgcaagcgcttggtcat
ccgccgggagcgctgaagatcctgattgtacagcttgtccgattgatgcgtgggaccgag
caggtccggatgtccaagcgggccgggcagttcgtgacgatgggggagttggtcgatgag
gtgggacgggatgcagcacgctacacctttcttacccgacggtgcgacagccagttagac
ttcgatctggagcttgtcaaatcggcgtctgaggagaacccggtttactacgtgcagtac
gcccacacccgcctctgcggcatcctccgggaggcgaccagggcgcaacttccggtccca
tcccccgaagacaacctcgatcggctcgatctgccggaagagatcgggttgatcaagcaa
ttggcgctctatcccgaactggtcatcggggcggcgcaagcgctggagccgcacagactc
accacctatctgcacgacctcgccgcgcagtttcacggctactacgctcgccatcggatt
atctccgccgataccaatctcacgcgcgcccgcctgacgctggtggctgcccttcgcgtg
gtcatggccaacacactgggcttgctgggcgtctccgcccccgagcgcatgtag

DBGET integrated database retrieval system