KEGG   Candidatus Methylomirabilis oxyfera: DAMO_1844
Entry
DAMO_1844         CDS       T02155                                 

Gene name
tyrS
Definition
(GenBank) Tyrosyl-tRNA synthetase (Tyrosine--tRNA ligase) (TyrRS)
  KO
K01866  tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
mox  Candidatus Methylomirabilis oxyfera
Pathway
mox00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mox00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DAMO_1844 (tyrS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mox01007]
    DAMO_1844 (tyrS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mox03016]
    DAMO_1844 (tyrS)
   03029 Mitochondrial biogenesis [BR:mox03029]
    DAMO_1844 (tyrS)
Enzymes [BR:mox01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.1  tyrosine---tRNA ligase
     DAMO_1844 (tyrS)
Amino acid related enzymes [BR:mox01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   DAMO_1844 (tyrS)
Transfer RNA biogenesis [BR:mox03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    DAMO_1844 (tyrS)
 Prokaryotic type
    DAMO_1844 (tyrS)
Mitochondrial biogenesis [BR:mox03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    DAMO_1844 (tyrS)
SSDB
Motif
Pfam: tRNA-synt_1b S4
Other DBs
NCBI-ProteinID: CBE68894
UniProt: D5MGL3
LinkDB
Position
complement(1587897..1589144)
AA seq 415 aa
MNDLKAQAYEQLCAIRRGAVEIMSDAELLEKLERSLRTGIPLRIKLGADPSAPDLHLGHT
VVLRKLRQFQDFGHQVIFLIGDFTGMIGDPTGRSETRKPLSVEEVQANADTYKRQIFRIL
DEDRTEIRFNSEWLSRMDFAGVIRLAAQHTVARLLERDDFQKRYREGRPIGVHEFLYPLA
QGYDSVVLRADVELGGTDQKFNLLVGRELQRAYGQEPQVALITPLIEGTDGVQKMSKSLG
NYIGIDEPAREVYGKAMSIPDELIVKYAELVAGVLPEAVEAMDEGLKLGTLHPRTAKAKV
AWELVALYRGEQAAEEAALEFDRMFRDKRLPDEISLFAVEDERAAVDLVWLIKESGGTKS
LSEARRLIRQGGVSLDGQVVRNECARVSLDCEHLLKVGKRFFRRVKKSVPTPKNT
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgaatgatctgaaagcgcaagcctatgagcaactgtgcgccattcggcgtggtgcggtg
gagattatgtcggacgcagagttgcttgagaagctcgagcgctcgttgcggaccggcatt
ccgcttcgcatcaaactcggcgccgacccctcagcgccggacctgcacctcggccacacg
gtcgtcctgaggaagctgcgccagtttcaggatttcggccaccaggtgatattcctcatt
ggcgattttaccggtatgatcggcgacccgacgggtagatcagagacccgtaagccattg
agcgttgaggaagtgcaggcgaacgcggatacgtataagaggcagatatttcggatcctc
gatgaagatcgaacggagatccgctttaacagtgagtggctgagtcgaatggatttcgcc
ggcgtgatccgtctggcggcacagcatacggtcgctcgactgctcgagcgggacgatttc
caaaagcgataccgggagggacggcccatcggcgttcatgagtttctgtacccactggct
caagggtatgattccgtggtgctcagggctgatgtcgaattaggcggcaccgatcagaag
tttaatctacttgtaggacgggagttgcagcgggcgtatgggcaggaacctcaagttgcg
ctcatcacgcccctgattgaagggaccgatggcgttcaaaagatgagcaagagtctcggc
aactatattgggattgatgagccggccagggaggtatatgggaaggccatgtcgattcca
gatgagctgattgtgaaatatgccgagctggtggccggggtattgccggaggccgtagag
gctatggatgagggattgaagctcggcacccttcatcccaggacagcgaaagccaaggtg
gcctgggagctggttgcgctctaccggggggagcaggccgccgaggaggcggctctcgag
ttcgaccggatgttccgagacaagaggctgccggacgagatcagtctgtttgcggtggag
gatgagcgagctgcggttgatctcgtctggctgatcaaggaatcaggagggacgaagagc
ctctcggaagcccggaggcttatccgccagggtggggtcagtcttgacgggcaggtggtg
cggaatgaatgtgcgcgagtatcgctggattgcgaacacttactgaaggtagggaagcga
tttttccgtagagtaaaaaagagcgttcccaccccaaaaaacacttga

DBGET integrated database retrieval system