KEGG   Candidatus Methylomirabilis oxyfera: DAMO_2166Help
Entry
DAMO_2166         CDS       T02155                                 

Gene name
cbbS
Definition
(GenBank) Ribulose bisphosphate carboxylase small chain (RuBisCO small subunit)
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
mox  Candidatus Methylomirabilis oxyfera
Pathway
mox00630  Glyoxylate and dicarboxylate metabolism
mox00710  Carbon fixation in photosynthetic organisms
mox01100  Metabolic pathways
mox01120  Microbial metabolism in diverse environments
mox01200  Carbon metabolism
Module
mox_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:mox00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    DAMO_2166 (cbbS)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    DAMO_2166 (cbbS)
Enzymes [BR:mox01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     DAMO_2166 (cbbS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small DUF772
Motif
Other DBs
NCBI-ProteinID: CBE69216
UniProt: D5MHI4
LinkDB All DBs
Position
1872152..1872574
Genome map
AA seq 140 aa AA seqDB search
MRITQGTFSFLADLTDDQIRKQVEYALNNKWAVSVEFTDDPHPRNTFWEMWGLPMFDLED
PAGVMYEIDACRKAYPNHYIKVNAFDHNKGWETIRLSFIIHRPPHEPGFGLVRQEVKGRT
VNYVVHSYATDKPEGARYTD
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatcacccaaggtacgttctcgttcctggctgatctgaccgacgaccagatcaga
aagcaggtagagtatgcattgaacaataaatgggccgtcagtgtcgagtttacggatgac
ccgcatccccgcaatacgttctgggaaatgtgggggttgccgatgttcgacctggaagac
ccggcgggggtcatgtatgagatcgatgcttgccgcaaggcctatcccaaccactatatc
aaggtgaacgccttcgaccataacaaaggttgggaaaccatccgtctgtcgttcattatc
catcggccgccgcatgagccgggctttggccttgtgcgccaggaagtcaaaggccgcacc
gtcaactatgtcgtgcacagctatgctaccgacaagccggagggcgcgcggtatacggac
tga

DBGET integrated database retrieval system