KEGG   Candidatus Methylomirabilis oxyfera: DAMO_2168Help
Entry
DAMO_2168         CDS       T02155                                 

Gene name
ppcA
Definition
(GenBank) Phosphoenolpyruvate carboxylase (PEPCase) (PEPC)
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mox  Candidatus Methylomirabilis oxyfera
Pathway
mox00620  Pyruvate metabolism
mox00680  Methane metabolism
mox00710  Carbon fixation in photosynthetic organisms
mox01100  Metabolic pathways
mox01120  Microbial metabolism in diverse environments
mox01200  Carbon metabolism
Module
mox_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mox00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DAMO_2168 (ppcA)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    DAMO_2168 (ppcA)
   00680 Methane metabolism
    DAMO_2168 (ppcA)
Enzymes [BR:mox01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     DAMO_2168 (ppcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2
Motif
Other DBs
NCBI-ProteinID: CBE69218
UniProt: D5MHI6
LinkDB All DBs
Position
1873695..1875191
Genome map
AA seq 498 aa AA seqDB search
MIDVATLRRIPRCMSTQHPDNVTVPFFAQGPVMEGMDEIREAYYAFSHLGCDEQMWDFEG
KEVDDFVVEKLLTTYEGFFRAFPLGREMFLTLRVPNPAVEKSQGKILLEVLQGIPRANDV
ARLFYGEDVAPIFEIIFPMTTSAEELDRVHRYYQVFVTGKGEAVMTPGDIPLKEWIGEFH
PAAIQIIPLIEDKESLLQADAIVRTYLQDKDLSCQRVFLARSDPALNYGSLAARLLVKVA
LSRLDSLEQELGIPIYPIFGAGSAPFRGNFRPDTVERNLAEHPSVQTFTIQSAFKYDHPA
PAIIQAIETLKSTPRKRAQPIEPEGKILDLIERISACYQRQVRAIAPLLNDVAPAVPRRR
MRKLHIGLFGYSRSIGGISLPRAISFCAALYSIGLPPEILGLSCLNQNDLTLLREVDPGF
EADLGDALQHLNDEVYTFLPSTEAEEIRRTVQLLRPTLSQDHAHREVTATIIRRVGKGHS
KDLGDLILRAAWIRKFLG
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgattgatgtcgcgaccctccgccgtatcccccggtgcatgagtacccagcacccggac
aacgtgaccgtccccttcttcgcccaaggacctgtgatggaggggatggacgaaatccgg
gaggcgtactacgccttctctcatttaggctgcgatgagcagatgtgggacttcgagggg
aaggaggtcgatgacttcgtcgtcgagaagctcctgacgacctacgaggggtttttcagg
gcgtttcccctgggacgggagatgttcctgaccttacgagttccaaaccctgcggtggaa
aaatcgcaggggaaaatcctccttgaagttctccagggaatccccagagccaacgacgta
gcccgccttttctatggggaggatgtcgcccccatcttcgaaatcatcttccccatgacc
acctcggcggaggaactggaccgtgtgcaccggtactatcaggtcttcgtcacggggaag
ggggaggcggtcatgacccccggtgatatccctctcaaagagtggattggcgagttccac
cccgccgcgattcagatcatccccttaatcgaggataaggagtcgctgcttcaggccgat
gctattgtccgcacgtatcttcaggacaaagacctctcgtgccagcgcgtcttcctggcc
cgctccgatccggccttgaactatggcagcctggcggccagactcctggtcaaggtggcc
ttgagccgcctggacagcctggagcaggagcttggcatccctatttatccgatcttcggg
gccggcagcgccccgtttcgaggtaacttccgacctgacaccgtggaacgaaacctggct
gagcatccgagcgttcagacgtttacgatccagtcagccttcaaatacgaccatccggct
cctgcgatcatccaggccatcgagaccttgaagagcacgcccagaaagcgcgcccaaccg
atagagccggaggggaagatcctcgatctgattgagcgaatctccgcgtgctaccagcgc
caagtgagagcaatcgcccccctgctgaacgacgtcgccccagccgtcccccggcggcgg
atgcggaagcttcacatcggtctgtttggctacagccggagtatcggcggaatctcgctt
cccagagccatctccttctgcgccgccctctactccataggcctcccccctgagattctc
ggcctctcctgtctcaatcagaacgatctgacccttctgagggaggtcgatccggggttc
gaagccgacctcggagatgccctccagcatctgaacgatgaggtgtacaccttcctcccc
tccactgaagcggaagagattcggaggactgtccaactccttcgtcctactctctcccag
gatcatgcccaccgtgaggtcacagcaacgattatcaggcgggttgggaagggacacagc
aaggacctcggcgatctcatcctccgggcggcttggattcgaaagtttttgggctga

DBGET integrated database retrieval system