KEGG   Candidatus Methylomirabilis oxyfera: DAMO_2610
Entry
DAMO_2610         CDS       T02155                                 

Definition
(GenBank) Aminotransferase
  KO
K20428  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase [EC:2.6.1.33]
Organism
mox  Candidatus Methylomirabilis oxyfera
Pathway
mox00525  Acarbose and validamycin biosynthesis
mox01100  Metabolic pathways
mox01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mox00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    DAMO_2610
Enzymes [BR:mox01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.33  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase
     DAMO_2610
SSDB
Motif
Pfam: Aminotran_3
Other DBs
NCBI-ProteinID: CBE69683
UniProt: D5MK61
LinkDB
Position
complement(2245948..2247309)
AA seq 453 aa
MAAASRKEGSAPMKRHIPGKRSKAIVAREQRHMAPGLQSIALYSGLAMARGEGCTLTDED
GNRYLDFMAGIGVGSIGYTHPHYVEAMKAQIERLTFGSFTTENRARFLTLLASITPGRLK
RIQMFSGGAEAVEAAFRLAKSATKKFEFVGFWGAFHGKTGGVLGLLGDDFKKQLGPFVPG
LYSAPYANCYRCPLKLRYPDCGLACADFLREVIRYQTQGEIAAIIVEPIQGTAGNVIPPP
GFLSAVQTIAKECGALLIADEMLTGFGRTGSMWGCDHEPMVPDVMTVGKGMGGGFPVSGV
ISTQELMANKPFSNPSGSSSSYGGNPLAATAGLAALEVILKERLVANAKRVGAVMLKQLE
AMKEKYPFIGDVRGRGLLLGIELVKDRQTKEPLPKSLTQKLFQSCLKRGLLAMCYSYNIR
INPPLIITEQQALEGLAILDQAFAELNKTGYRG
NT seq 1362 nt   +upstreamnt  +downstreamnt
atggctgctgcatcgcgtaaggaggggagcgctccaatgaagcgacacattcctggaaaa
cggtcgaaggcgattgttgcccgcgagcaacgccatatggcgccgggcctacagtcgata
gcgctgtattccgggttggcgatggcgagaggggaagggtgtaccctgaccgatgaggac
ggcaaccgatacctcgatttcatggccggaatcggtgtggggagtatcgggtatacgcac
ccgcactatgtcgaggccatgaaggcccagatcgaacggctgacgttcggcagcttcacc
accgaaaaccgggcccggtttctcacgctgctggcatcgatcacaccgggacggctgaag
cggatccagatgttttccggtggggcggaggcggtcgaggctgccttccgactggccaag
tcggccacgaagaagttcgagttcgtcgggttttggggcgcgtttcatggtaagacaggc
ggggtcctggggctgctgggggatgattttaagaagcagttgggaccgttcgtacccggc
ctctacagcgccccatacgccaactgctatcgctgtcccttgaagcttcgctatcccgat
tgcggtcttgcctgtgcggacttcttgcgcgaggtgatccgctatcagacccagggtgag
atcgctgcgatcatcgtggagccgattcaggggactgccggaaacgtcattccgccccca
ggattcttgagcgcggtgcagacgattgccaaggagtgcggtgccctattgattgccgat
gagatgctgacgggcttcggccgcaccggttcgatgtgggggtgcgatcacgagccgatg
gtgccggacgtgatgacagtgggaaagggaatgggcggcgggttcccggtcagcggggtg
atctcgacacaggaactgatggcgaacaaacccttcagcaatccgagcggaagttcctca
agctatggaggcaatccgcttgccgcaacagccggactcgctgccctcgaggtcatcttg
aaggaacggcttgtcgcgaatgccaagcgtgtcggcgcggtcatgctgaagcaactggaa
gcaatgaaggagaaatacccgtttatcggcgatgtgcgtggtcgagggctcttacttggc
atagaactggtcaaggacaggcagaccaaggagccgcttccgaaatctctcacccagaag
ctgtttcagagctgcctcaaacgggggctgctggccatgtgctattcctacaacatccgg
atcaacccgcctctcatcatcactgaacagcaggcattggaaggtctggctatcctcgat
caggcctttgccgagctcaataagacagggtataggggatga

DBGET integrated database retrieval system