KEGG   Candidatus Methylomirabilis oxyfera: DAMO_2797Help
Entry
DAMO_2797         CDS       T02155                                 

Gene name
aor
Definition
(GenBank) Tungsten-containing aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
mox  Candidatus Methylomirabilis oxyfera
Pathway
mox00030  Pentose phosphate pathway
mox01100  Metabolic pathways
mox01120  Microbial metabolism in diverse environments
mox01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mox00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    DAMO_2797 (aor)
Enzymes [BR:mox01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     DAMO_2797 (aor)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: CBE69870
UniProt: D5ML28
LinkDB All DBs
Position
2403952..2405760
Genome map
AA seq 602 aa AA seqDB search
MGWTGTILRVNLSSGSVAKEPLDRHLARAYIGGRGLATKILYDEIDPTLDPLGPANKLIL
ATGPLTGTNAPTGGRYMVVTKSPLTGAIACSNSGGYIGAEMKYAGYDLVIVEGKAPHPVY
LWVNNDQVELRDAAHVWGRSTHETEDTLRAATSAEAKICSIGPAGETLSLTAAVINDKHR
AAGRSGVGAVMGSKNLKAVVFRGTQSVKVAHPQAFMQACLLAVAKLKADHGSGEGLPTYG
TPGIVNVINAHGFMPTNNFQFGQFAGADKISGETIHDQILIRNKGCFACTIACARVTEVK
AGTFKGSGEGPEYETVWGLGAMTGVDDLAAVTKAGYLCNELGMDTIEAGVAIATAMELFE
RGYIPEREIGRPLRFGDADALVEMTEKLGRGDGFGAILALGGARLAERYGHPELFMGVKR
QAFAAYDGRGAQGIGLGYATSNRGACHLRGYTIAAEVFGVPHKMDPFTTEGKAALAKSSQ
DATAFVDSTGTCVFTTFALGPADLHAMLELATDAGYTVEEVLTIGERIWNLERLFNLRAG
LSAKDDTLPHRILKEPIPAGPAKGKVARLGEMLPEYYRLRGWDPQGVPTQEKLKDLGLYP
TP
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgggctggaccgggacgatcctcagagtcaacctgagcagcggcagcgtggcgaaggag
cccctggaccgccatctcgccagggcgtacatcggcggtcgcggcctggcgacgaagatc
ctgtacgatgagatcgacccgacgctcgatccgcttgggccggctaataaactgatcctc
gccaccggcccgctcaccggcacgaacgccccgaccggcggcagatatatggtggtgacc
aagtcgccgctcaccggcgcgatcgcctgctccaattccggcgggtacatcggagccgag
atgaagtacgccgggtacgacctggtgattgtggaggggaaggcgccgcatccggtgtat
ctctgggttaacaacgatcaggtagagcttcgggacgccgcccacgtttgggggcggtcc
acgcacgagaccgaggacacccttcgagcggccaccagcgccgaggctaagatctgcagc
atcgggccggcgggggagacgttgagcctgaccgccgccgtgattaacgacaagcatcgg
gctgcagggcgctccggggtaggcgcggtgatgggatcgaaaaacctgaaggccgtcgtc
ttccggggtacccagtcggtgaaggtcgcgcacccccaagcgttcatgcaggcctgcctc
ctggccgtggcgaagctcaaggcagaccatggttcgggagaaggtctgccgacgtacggc
acgccagggattgtgaacgtcattaacgcccacggcttcatgccgaccaacaactttcag
ttcggtcagtttgccggcgccgacaaaatcagcggcgagaccatccatgaccagatcctg
atccggaacaagggctgctttgcgtgtaccatcgcctgcgcgcgggtcactgaggtcaag
gccggaacgttcaaggggtcgggcgaggggccggagtacgagaccgtctggggccttggc
gccatgaccggtgtggacgatctggctgccgtcaccaaggccggctatctctgcaatgag
ctggggatggatacgatcgaggcaggggtggccatcgctaccgctatggagctgttcgag
cggggctacatcccggagcgtgagatcggccgcccacttcggttcggcgatgcggatgcg
ctggtggagatgacggaaaagctgggcaggggagatgggtttggcgcgattctggcgcta
ggcggcgcgcggctcgccgagcggtacggccaccctgaactgttcatgggggtcaaacgg
caggcgttcgccgcgtatgacgggcgaggggctcaagggatcggactggggtatgcgacc
tctaaccggggtgcttgtcacctgcgcggctacaccatcgcggctgaggtattcggtgtt
ccgcacaagatggatcccttcaccaccgaggggaaagcggcgcttgccaaatcgtcccag
gacgccaccgcctttgtcgattcgaccggcacctgcgtattcactacctttgccctggga
ccagcggatctgcacgccatgttggagctggcgacggacgccggctatacggtggaggaa
gttctcacgatcggcgagcggatctggaacctggagcggctctttaacctcagggccggc
ctcagcgccaaagacgacaccctgcctcatcgcatcctgaaggagccgattccagcggga
ccggccaaggggaaggtggcccgcctcggcgagatgctcccggaatactatcgccttcga
ggctgggacccgcaaggtgtgccgacgcaagagaaactgaaggatctaggcctctacccc
acaccctaa

DBGET integrated database retrieval system