KEGG   Candidatus Methylomirabilis oxyfera: DAMO_2993
Entry
DAMO_2993         CDS       T02155                                 

Gene name
era
Definition
(GenBank) GTP-binding protein (era)
  KO
K03595  GTPase
Organism
mox  Candidatus Methylomirabilis oxyfera
Brite
KEGG Orthology (KO) [BR:mox00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mox03009]
    DAMO_2993 (era)
   03029 Mitochondrial biogenesis [BR:mox03029]
    DAMO_2993 (era)
Ribosome biogenesis [BR:mox03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   DAMO_2993 (era)
 Prokaryotic type
  GTPases
   DAMO_2993 (era)
Mitochondrial biogenesis [BR:mox03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    DAMO_2993 (era)
SSDB
Motif
Pfam: MMR_HSR1 KH_2 FeoB_N Dynamin_N GTP_EFTU RsgA_GTPase AIG1 AAA_22 Ras PduV-EutP MMR_HSR1_Xtn Roc ABC_tran SRPRB AAA_29
Other DBs
NCBI-ProteinID: CBE70066
UniProt: D5MME4
LinkDB
Position
2584956..2585858
AA seq 300 aa
MDMTNDKSGFVAIIGRPNVGKSTLMNRLLGQKVSIVSPRPQTTRTKIMGIRSLPGAQLIF
LDTPGIDKSGGYFHRLMVKTATNSLEGADLILWIVEAPDPLSQGDKLILEILKRVTSPIL
LAVNKVDLVQKESLLPTIDRFRSLLPFAEIVPISATKGDNVALLESLLVQYLPEGPPLYP
PDQLTDQPDRFIIAELIRERVFRSVYQEVPYAVAVLVEKVRTREGRALTDVEATIYVEKD
SQKAIIIGRGGAMLKRIGELVRPEIERLLGTQVFLKLWVKVRSDWQKDDEALRRLGYLQQ
NT seq 903 nt   +upstreamnt  +downstreamnt
atggacatgaccaacgataaatcaggttttgtagcgattattggccgccccaacgtcggc
aaatcgaccctcatgaaccgtctgctgggacagaaggtgtcgatcgtctctcccaggccg
cagacgaccagaaccaaaattatggggatcaggagcctgcccggagcgcaattgatcttc
ctggatacgcctgggatcgataagtcgggcggctattttcaccggttgatggtgaaaaca
gccacaaacagtctggaaggggcagacctgatcctctggatagtggaagctcccgatccg
ctctctcagggtgacaaactgatcctggagattctgaagcgggtcacgtctccgatcctg
ctcgccgtcaataaggtcgatctcgttcagaaagaaagcctgttgcccacaatcgatcgc
ttccggtcgctgctgccgtttgccgagatcgtaccgatctccgctacgaaaggcgacaac
gttgcgcttctcgagtcgctgctggtccaatatctcccggagggaccaccgctgtacccc
cctgatcagttgaccgaccagccagatcgtttcatcatcgccgagctgatccgagagcgg
gtcttccgctcggtctatcaggaggtgccgtatgcggtggccgtgttggtagaaaaggtc
agaacacgggaagggcgagcgctgaccgacgtcgaggcaaccatttatgtcgagaaggac
tcacagaaggcgatcatcatcggacgcgggggcgccatgctcaagcgaatcggggagctg
gtcaggccggagatcgagaggctgctcggcacccaggtgtttctgaagctgtgggtcaag
gttcgcagcgactggcagaaggatgatgaggcgctaaggcggctcggctatctgcaacag
tag

DBGET integrated database retrieval system