KEGG   Candidatus Methylomirabilis oxyfera: DAMO_3087
Entry
DAMO_3087         CDS       T02155                                 

Gene name
rpsP
Definition
(GenBank) 30S ribosomal protein S16
  KO
K02959  small subunit ribosomal protein S16
Organism
mox  Candidatus Methylomirabilis oxyfera
Pathway
mox03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mox00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    DAMO_3087 (rpsP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mox03011]
    DAMO_3087 (rpsP)
   03029 Mitochondrial biogenesis [BR:mox03029]
    DAMO_3087 (rpsP)
Ribosome [BR:mox03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    DAMO_3087 (rpsP)
  Bacteria
    DAMO_3087 (rpsP)
Mitochondrial biogenesis [BR:mox03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    DAMO_3087 (rpsP)
SSDB
Motif
Pfam: Ribosomal_S16
Other DBs
NCBI-ProteinID: CBE70160
UniProt: D5MMN8
LinkDB
Position
complement(2676745..2677026)
AA seq 93 aa
MSVKIKLRRMGAKAHPFYRLVVGDAPVAVGGKVLETLGTYDPHGDPPALSVQAERALHWL
QRGAEPTDSARQLLRRAGVMRQLAELKAAGKGQ
NT seq 282 nt   +upstreamnt  +downstreamnt
atgtccgtaaagattaagttgcggcggatgggggctaaggcgcatcccttctatcgcctg
gtggtgggagatgcgccggtcgcggtgggcggcaaggtcctggagactctgggcacctac
gatcctcacggcgatccgcctgcgctgtccgtacaggccgagcgcgcattgcattggttg
caacggggcgctgagcctaccgacagcgccaggcagcttttgcgtcgggcaggcgtcatg
cgtcagttggctgagctgaaagccgccggcaagggccaataa

DBGET integrated database retrieval system