KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP_0341Help
Entry
MAP_0341          CDS       T00156                                 

Gene name
ligC
Definition
(GenBank) LigC
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AAS02658
UniProt: Q744K0
LinkDB All DBs
Position
366577..367686
Genome map
AA seq 369 aa AA seqDB search
MDLPVMPPVSPMLAKSVGAIPPAASYEPKWDGFRSICFRDGDEVELGSRNERPMTRYFPE
LVAAVRAELPQRCVIDGEIVIATDHGLDFEALQQRVHPAESRVRMLAEATPASFIAFDLL
ALGDEDYTGRPFRERRAALLEAVGGPGPSIHVTPATTDLDTARRWFDEFEGAGLDGVVAK
PLDITYQPDKRVMFKIKHERTADCVVAGYRVHKSGADAIGSLLLGLYQDDGQLASVGVIG
AFPMAERRRLFTELQPLVTDFEDHPWNWAAHQAGERTPRKNEFSRWNAGKDLSFVPLRPE
RVVEVRYDHMEGRRFRHTAQFNRWRPDRDPRSCTYEQLEQPVTFRLDDIVPGLGASRADH
KPGKQIGAP
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggaccttcctgtcatgccgccggtgtcgccgatgctggcgaagtcggtcggcgcgatt
cccccggccgcgtcgtatgagcccaagtgggacggcttccggtcgatctgtttccgcgac
ggcgacgaggtcgagttgggcagccgcaacgagcggccgatgacgcgctacttccccgaa
ttggtggcggcggtgcgggcggagctgccgcagcgctgcgtgatcgacggggagatcgtc
atcgccaccgaccacggcctggacttcgaggcgctgcaacaacgcgtccatccggccgag
tcgcgggtgcggatgctggccgaggccacgccggcgtcgttcatcgccttcgacctgctg
gcgctgggcgacgaggactacaccggccggccgttccgcgagcggcgcgcggcgctgctg
gaggcggtgggcggtccggggccctcgatccatgtcacgccggcgaccaccgatctggac
accgcgcggcggtggttcgacgaattcgagggcgccgggctcgacggtgtggtcgccaag
ccgttggacatcacgtatcagccggacaagcgggtgatgttcaagatcaaacacgagcgg
acggccgactgtgtggtggccggttatcgggtgcacaagtccggggcggacgcgatcggc
tcgttgttgctggggctgtatcaggatgacggccagctcgcgtcggtcggcgtgatcggc
gccttcccgatggccgagcggcggcggctgttcaccgaattacagccgctggtcaccgat
ttcgaggaccacccgtggaactgggccgcgcaccaggccggcgagcgcacgccccgcaag
aacgagttctcgcgctggaacgccggcaaggacctctcgttcgtcccgctgcggcccgag
cgggtggtcgaggtccgctatgaccacatggagggccggcgattccgtcataccgcgcag
ttcaatcgatggcggccggaccgcgacccacgctcctgcacctacgaacagctcgagcag
ccggtgacgtttcgcctggacgacatcgtgccgggcctcggcgcgagccgcgcagatcac
aagcccggcaagcagattggggctccatag

DBGET integrated database retrieval system