KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP_0880
Entry
MAP_0880          CDS       T00156                                 

Definition
(GenBank) hypothetical protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
mpa03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mpa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    MAP_0880
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mpa03400]
    MAP_0880
Enzymes [BR:mpa01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MAP_0880
DNA repair and recombination proteins [BR:mpa03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     MAP_0880
SSDB
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_primase_S
Other DBs
NCBI-ProteinID: AAS03197
UniProt: Q742F5
LinkDB
Position
904272..906566
AA seq 764 aa
MNAPRAWPAEPTATPRVKLTNADKVLYPATGTTKADVFDYYTRIADVMIPHIAGRPVTRK
RWPNGVDQESFFEKQLASSAPDWLPRASVTHRSGTTTYPIIDSATGLAWIAQQAALEVHV
PQWRFVAEWTRSRAEELKPGPATRLVFDLDPGEGVTMAQLAEVARAVRDLIDGIGLQTFP
LTSGSKGLHLYTPLTEPVSSKGATVLAKRVAQQLEKTMPKLVTSTMTKSLRAGKIFVDWS
QNNGSKTTIAPYSLRGRDHPTVAAPRTWDELDDPALRHLRYDEVLTRVARDGDLLAELDD
NQTPVPDRLTKYRSMRDASKTPEPVPDAKPAAGQGNTFVIQEHHARRLHYDFRLERDGVL
VSWAVPKNLPDTPAVNHLAVHTEDHPLEYGGFEGVIPKGEYGAGRVVIWDSGTYDAEKFQ
DDEVIVNLHGRKISGRYALIQTQGDQWLAHRMKDQNVFEFDTIAPMLATHGSVSALKASQ
WAFEGKWDGYRLLVEADHGTLRVRSRRGREVTGEYRELRSLAKALEEHHAVLDGEAVVLD
KRGVPNFHEMQNRGKSARVEFWAFDLLYLDGRSLLRARYRDRRKLLEMLASGGALTVPEL
LPGDGDQALRQSAERGWEGVIAKRRDSTYQPGRRSSSWIKDKHWNTQEVVIGGWKAGEGG
RSSGIGSLLMGIPGPGGLHFAGRVGTGFTERDLANLKKTLAPLRTDQSPFDAPLPRSEAK
GVTFVEPVLVGEVRYSEWTPDDRLRQSSWRGLRPDKEASEVVRE
NT seq 2295 nt   +upstreamnt  +downstreamnt
atgaacgcgccgcgcgcttggcccgctgagccgacagcgacgccgcgggtgaaactgacc
aacgccgacaaggtgctctatcccgcgacgggaaccaccaaagccgacgtcttcgactac
tacacgcggatcgccgacgtgatgatcccgcacatcgccgggcgtccggtcacccggaag
cgctggcccaacggcgtcgatcaggaatcgttcttcgaaaagcagctggcctcctcggca
ccggactggctgccgcgcgccagcgtgacccaccgatccggcacgacgacctatccgatc
atcgacagcgccaccggcctggcctggatcgcccagcaggcggcgctggaggtgcacgtg
ccgcagtggcggttcgtcgcggagtggacccgaagccgggccgaagaactcaaacccggc
ccggcgactcgactggtgttcgacctcgacccgggcgaaggcgtgacgatggcccagctc
gccgaggtggcgcgcgccgtccgcgacctgatcgatgggatcgggctgcagacgtttccg
ctcaccagcggcagcaagggactgcacctgtacacgccgctgacggagccggtgagcagc
aaaggcgccaccgtgctggccaaacgcgttgcgcagcaactggaaaagaccatgccgaag
ctggtcacctcgaccatgaccaagagcctgcgggcgggaaagatctttgtggactggagc
cagaacaacggctccaagacgaccatcgcgccctattcgctgcgcgggcgcgaccacccc
accgtcgccgcgccgcgcacctgggacgaactcgacgacccggcgctgcgtcacctgcgc
tacgacgaagtgctgacccgggtcgcccgcgacggtgacctgctcgccgagctggacgac
aaccagacaccggtgccggaccgcctgaccaaataccgcagcatgcgcgacgcctccaaa
acacccgagccggttccggacgcgaaacctgctgcgggacaaggtaataccttcgtcatc
caagagcaccacgcccggcggctgcactacgacttccggctggagcgcgacggggtgctg
gtgtcctgggcggtgccgaagaacctgcccgacacccccgcggtgaatcacctggccgtg
cacaccgaggatcacccgctggaatacggcgggttcgagggcgtcatccccaaaggcgaa
tacggggcgggcagggtggtcatctgggactccggaacctatgacgccgagaagttccag
gacgacgaggtgatcgtcaacctgcacggccgcaagatctccgggcgctacgcgctgatc
cagacccagggcgaccaatggctggcgcaccggatgaaggaccagaacgtcttcgagttc
gacacgatcgccccgatgctcgccacccacggttcggtgtcggcgctcaaggcgagccag
tgggcgttcgagggcaaatgggacggctaccggctactggtcgaggccgaccacggcacc
ctgcgggtgcggtcccggcgcggtcgcgaagtcaccggcgagtaccgcgaattacgctcg
ctggcaaaggctctcgaggagcaccacgcggtgctcgacggcgaggccgtggtgctggac
aagcgcggcgtgcccaacttccacgagatgcaaaaccgcggcaagagcgcgcgggtcgaa
ttctgggcgttcgacctgctctacctcgacggccgctcgctgctgcgggcccgctaccgc
gaccggcgaaaactgttggaaatgctggcctccggcggtgctctcaccgttcccgagctg
ctgcccggcgacggcgaccaagcgctgcggcagtccgccgagcgcggttgggagggcgtg
atcgccaagcggcgcgactccacctatcagcccggccggcgctcgtcctcctggatcaag
gacaagcattggaacacccaggaagtcgtgatcggcggctggaaggccggggaaggcgga
cgcagcagcggcatcggttccctgctgatgggcattccgggcccgggcggcctgcacttc
gccggccgcgtcggcaccgggttcaccgaacgcgacctagccaacttgaagaagacgctg
gccccgctgcgcaccgaccaatcgcccttcgatgcgccgcttccccgcagcgaggccaag
ggcgtcacgttcgtcgagccggtgctggtgggcgaggtgcgctacagcgagtggacaccg
gatgaccggctgcgccaatcgagttggcgcgggctgcggccggacaaggaagcaagcgag
gtggtacgcgagtga

DBGET integrated database retrieval system