KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP_1329cHelp
Entry
MAP_1329c         CDS       T00156                                 

Definition
(GenBank) hypothetical protein
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: AAS03646
UniProt: Q740M1
LinkDB All DBs
Position
complement(1421615..1422679)
Genome map
AA seq 354 aa AA seqDB search
MAERDRHGTDLAGTRRGAGAGAVTDFAALPDSVRAALRDEPVPQWCSPTLATLTEKRFSD
PHWIFERKFDGMRCLAFRDGDRVRLLSRNRKPLNGTYPELVESLAAQRETRFVLDGEVVA
FEGRRTSFARLQGRLGITDPDVARASSVRIYYYVFDLLHLDGKSTVAVPLIWRKRLLRKA
IDFTDPLRYAPHRVGDGMAAYRAACGRGDEGVIAKRAESAYDGRRSENWLKFKCVRDQEF
VVGGYTSPKGKRLELGALLLGYYQGDQLRYAGKVGTGFDEATLHRLHQLLSGIACDTTPF
TRSLVPEAGAHWVRPELVVQIGFTEWTRDGKLRHPRYLGIRTDKDPTEVIRETR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtggctgagcgagatcgacatggaactgacctggcggggacgcgccgcggcgccggagcc
ggcgccgtgaccgacttcgccgcgctgcccgattccgtgcgtgccgcgctgcgcgacgag
cccgtgccccagtggtgctcgcccacgctggccaccctcaccgagaagcgattctccgac
ccacactggatcttcgagcgcaagttcgacggcatgcgctgcctggccttccgcgacggc
gaccgggtccggctgctgtcgcgaaaccgtaagccgctcaacgggacctacccggaattg
gtggagtcgctggccgcgcagcgcgagacgcgcttcgtgctggacggcgaggtggtggcg
ttcgagggccgccgcaccagcttcgcccggctgcagggccggctgggcatcaccgacccc
gacgtggcccgggcatcgtcggtgcgtatctactactacgtgttcgacctgctgcatctc
gacggcaagtcgaccgtcgcggtgccactgatctggcgtaagagattgctgcgcaaggca
atcgacttcaccgatccgctgcggtatgcaccgcaccgggtcggggacgggatggccgcg
taccgggcggcgtgcggtcgtggtgacgagggtgtgatcgccaagcgggccgaatcggcc
tatgacggccgccgctcggagaactggttgaagttcaaatgcgtgcgcgaccaggaattc
gtggtcggcggctacaccagccccaagggcaagcggctcgagttgggcgccctgctgctg
ggctactaccagggggaccagttgcgctacgccggcaaggtgggcaccggtttcgacgag
gcgacgctacaccgcttgcaccagctgctgtccgggatcgcttgcgacacaacgccattc
acccggagtttggtgcccgaggccggcgcgcactgggtgcgcccggagctggtggtccag
atcgggttcaccgagtggacccgcgacggaaagctacgtcacccccgctatctcggcatc
cgcaccgacaaggatcccaccgaggtgatccgggagacgcgctga

DBGET integrated database retrieval system