KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP_2338Help
Entry
MAP_2338          CDS       T00156                                 

Definition
(GenBank) hypothetical protein
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AAS04655
UniProt: Q73XH1
LinkDB All DBs
Position
2628772..2630349
Genome map
AA seq 525 aa AA seqDB search
MIHPRLPDLSFFRYVSVNSKLRCGSGPAPIAASRRRPMTKNSDHRCYDELFIGGQWRKPA
NPQQLDVISPHSEQPIGHAQAAGPEDVDAAVAAARRAFDHGPWPRMSHAERMAKIEQLAT
IYAAHMDEMADLITDEMGSPRSFSRMGQGAAAATLIHLTLAAARDFPWTERRQGVLGEVH
LHRAPVGVVGAIVPWNVPQFLIMPKLIPALIAGCTVIVKPAPETPLDALWLAEMIEQLEL
PQGVVSVLPGGTDVGEALVRHPGVDKIAFTGSSAVGRRIAALCGERLKRVSLELGGKSAA
IILDDADIDKTVAGLKSAGLMNNGQACVAQTRILVSDRKHDEVVDALAAMMAELNVGDPA
DESTDIGPLVAQRQQRRVQEYIKSGRSEGARMVLGGEDSPAGRGWYVRPTLFADATNDMR
IAREEIFGPVLTVLRYRDEDDAIRIANETDYGLAGSVWTADVAHGLEVAAAVRTGTYGIN
MYTLDIGAPFGGFKQSGIGREFGPEGLHEYVELQTLVCKGQLPPL
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgatccatccgcggcttcctgacttgtccttttttcgctatgttagcgtcaatagcaaa
ttacggtgcggatccggtccagcgcccatcgctgcctcgaggaggcgcccgatgacgaag
aattccgaccatcgttgctacgacgaactgttcatcggcgggcagtggcgaaagccggcc
aatccgcagcagctcgacgtgatctcgccgcactccgagcagccgatcggccacgcccag
gcggccggtcccgaggacgtcgacgccgccgtcgccgccgcccgccgggccttcgatcac
ggcccatggccgcggatgagccatgccgagcggatggccaagatcgaacagctcgccacg
atctacgccgcgcacatggacgagatggccgacctgatcaccgacgagatggggtcgccg
cgcagcttcagccggatgggtcagggagcggccgccgcgacgctgatccacctcacgctg
gccgccgcccgggactttccctggaccgaacgccgccagggcgtgctcggcgaggtgcac
ctgcaccgggccccggtcggggtggtgggcgcgatcgtgccgtggaacgtgccgcagttc
ctgatcatgcccaaactgatcccggcgctcatcgcggggtgcacggtgatcgtgaaacca
gcacccgaaacccctttggacgctttatggttggccgagatgatcgagcagctggagctg
ccgcagggcgtggtgtcggtgcttcccggcggcaccgacgtgggcgaggcgctggtgcgc
cacccgggggtggacaagatcgcgttcaccggctcgagtgccgtggggcgccggatcgcc
gccctgtgcggggagcggctcaagcgggtgagcctggagttgggcggcaagtcggcggcg
atcatcctcgacgacgccgacatcgacaagaccgtcgccggcctgaagagtgcggggctg
atgaacaacgggcaggcctgcgtcgcccagacccgcatcctggtcagcgaccgcaagcac
gacgaggtcgtcgacgcactggccgccatgatggcggagctgaatgtcggcgatccggcc
gatgagtcgacggacatcggaccgcttgtcgcccaacggcaacagcgccgggtccaggag
tacatcaagtccggccgcagtgagggggcccgcatggtgctcggcggcgaggacagtccg
gccgggcgcggctggtatgtgcggccgacgctgttcgccgacgccaccaacgacatgcgt
atcgcccgggaggagattttcggcccggtgttgaccgtcttgcgttaccgcgacgaggac
gacgctatccgcatcgccaacgaaaccgattacggcctggccggttcggtgtggacggcc
gacgtcgcccacggcctcgaggtcgccgccgcggttcgcaccggcacgtacggcatcaac
atgtacaccctggacatcggcgccccgttcggtggattcaagcaatccggcatcgggcgg
gagttcggtcccgaggggctacacgagtacgtcgagcttcagacgctcgtgtgcaagggg
cagctgccgccgctgtga

DBGET integrated database retrieval system