KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP_3655cHelp
Entry
MAP_3655c         CDS       T00156                                 

Gene name
lipW
Definition
(GenBank) LipW
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 COesterase AXE1 Peptidase_S9 DLH Patatin BAAT_C
Motif
Other DBs
NCBI-ProteinID: AAS06205
UniProt: Q73TR3
LinkDB All DBs
Position
complement(4059631..4060530)
Genome map
AA seq 299 aa AA seqDB search
MPNNDVHPDLQRFARFAPRRLVGPRTLPLMRVALAWRGRLGKPVRDVEVITLGSGVGVRL
FRPAGAAETTPALLWIHGGGYVLGTAQQDDQLCSRFSRRLGITVASVDYRLAPEHRYPAP
LEDCYTALTWLAGLPSVDRYGIAIGGASAGGGLAAALALLARDRAEVSPAFQLLTYPMLD
DRSSDTAPSPNYRLWDNRSNRFGWAAYLGDADPHVAVPARRDDLSGLPPAWIGVGTHDLF
HDEDLAYAERLRAAGVPCQVETIPGAFHGFDLILPKVQVSQRFFDSQCNSLRAALTPAG
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtgccgaacaacgatgttcatcctgacctgcaacgatttgcccggttcgcgccgcgacga
ctggtcggcccgcgaacgctgccgctgatgcgggtggcgcttgcctggcgcgggcggctg
ggcaagccggtccgcgacgtcgaggtgatcacgctcggttccggggtgggggtccgcctg
ttccggcccgccggcgccgcggagacgacgcccgcgctgctgtggatccacggcggcggc
tacgtgctgggcaccgcccagcaggacgaccagctgtgcagccggttcagccgacggctg
ggcatcacggtcgcatcggtggattaccgcctggcgcccgaacatcggtatccggcgccg
ctggaggactgctatacggcgctgacctggctggccggtctgccgtcggtggaccgctac
ggcatcgccatcggcggggccagcgccggcggcggcctggccgcggcgctggcgctgctg
gcccgcgaccgcgccgaggtgagccccgcattccagctgctgacctatcccatgctcgac
gaccgcagctcggacaccgcgcccagcccgaactatcggctgtgggacaaccgcagcaac
aggttcggctgggcggcctacctcggcgacgccgacccgcacgtcgcggtgcccgcccgg
cgggacgacctcagcggactgccgccggcctggatcggggtgggcacccatgacctgttt
cacgacgaggacctcgcctacgccgaacggctgcgggccgccggggtgccctgccaggtg
gagaccatccccggcgccttccacggcttcgacctgattttgccgaaagttcaagtgtcg
cagcggtttttcgacagccagtgcaacagcctgcgggccgcgctgacgccggccggctga

DBGET integrated database retrieval system