KEGG   Mus pahari (shrew mouse): 110312793
Entry
110312793         CDS       T05929                                 

Gene name
Ywhag
Definition
(RefSeq) 14-3-3 protein gamma
  KO
K16198  14-3-3 protein gamma/eta
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04110  Cell cycle
mpah04114  Oocyte meiosis
mpah04151  PI3K-Akt signaling pathway
mpah04390  Hippo signaling pathway
mpah05160  Hepatitis C
mpah05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110312793 (Ywhag)
   04151 PI3K-Akt signaling pathway
    110312793 (Ywhag)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110312793 (Ywhag)
   04114 Oocyte meiosis
    110312793 (Ywhag)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110312793 (Ywhag)
  09172 Infectious disease: viral
   05160 Hepatitis C
    110312793 (Ywhag)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mpah01009]
    110312793 (Ywhag)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mpah03400]
    110312793 (Ywhag)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110312793 (Ywhag)
Protein phosphatases and associated proteins [BR:mpah01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110312793 (Ywhag)
DNA repair and recombination proteins [BR:mpah03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    110312793 (Ywhag)
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110312793 (Ywhag)
SSDB
Motif
Pfam: 14-3-3 DUF3504 SF3A2 Peptidase_C98 Orbi_VP5
Other DBs
NCBI-GeneID: 110312793
NCBI-ProteinID: XP_021042338
Ensembl: MGP_PahariEiJ_G0024427
LinkDB
Position
23
AA seq 247 aa
MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSW
RVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESK
VFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYS
VFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDD
DGGEGNN
NT seq 744 nt   +upstreamnt  +downstreamnt
atggtggaccgcgagcaactggtgcagaaagcccggctggccgagcaggcggagcgctac
gacgatatggccgcggccatgaagaacgtgacagagctgaatgaaccactgtccaatgag
gaacggaacctcctgtcggtggcctacaagaacgtggttggggctcgccgctcctcctgg
agggtcatcagcagcatcgagcagaagacatccgcggacggcaacgagaagaagatcgag
atggtccgagcctaccgggagaagatcgagaaggagctggaggccgtgtgccaggacgtg
ctgagcctgctggacaactacctgatcaagaactgcagcgagacccagtacgagagcaag
gtgttctacctgaagatgaaaggggactattaccgttacctggcggaagtggccaccggg
gagaagagggcgactgtggtggagtcgtccgagaaggcctacagcgaagcccacgagatc
agcaaagagcacatgcagcccacccacccgatccggctgggcctggcgctcaactactcc
gttttctactacgagatccagaacgccccggagcaagcctgccacctggccaagaccgcc
ttcgacgacgccatcgccgagctcgacaccctgaacgaggactcctacaaggactccact
ctgatcatgcagctgctccgagacaacctcacgctctggacgagcgaccagcaagacgac
gacggcggcgaaggcaacaactaa

KEGG   Mus pahari (shrew mouse): 110313584
Entry
110313584         CDS       T05929                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: 14-3-3 protein zeta/delta-like
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04110  Cell cycle
mpah04114  Oocyte meiosis
mpah04151  PI3K-Akt signaling pathway
mpah04390  Hippo signaling pathway
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110313584
   04151 PI3K-Akt signaling pathway
    110313584
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110313584
   04114 Oocyte meiosis
    110313584
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110313584
  09172 Infectious disease: viral
   05161 Hepatitis B
    110313584
   05160 Hepatitis C
    110313584
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mpah03400]
    110313584
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110313584
DNA repair and recombination proteins [BR:mpah03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    110313584
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110313584
SSDB
Motif
Pfam: 14-3-3 MHC_I_3 DUF496 CRISPR_Cse1 CSN7a_helixI FliM
Other DBs
NCBI-GeneID: 110313584
NCBI-ProteinID: XP_021043672
LinkDB
Position
X
AA seq 246 aa
MNKNELVQKAKLAELAERYNDMAACMKSVTEQGVELSNEERNLLSVAYKNVVGARRSSWR
VVSSIEQKTEGAEKKQQMAREYREKIETELRDICKDVLLSLLEKFLIPNASQPESKVFYL
KMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYY
EILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRNNLTLWTSDTQGDEAEA
GEGGEN
NT seq 741 nt   +upstreamnt  +downstreamnt
atgaataaaaatgagctggtgcagaaggccaagctggccgagctggcagagcgatataat
gacatggcagcctgcatgaagtctgtcactgagcagggagtggagctgtcgaatgaggag
aggaaccttctctctgttgcttataaaaacgttgtaggagcccgtaggtcatcttggagg
gtcgtctcaagtattgagcagaagacggaaggtgctgagaaaaagcagcagatggctcga
gaatacagagagaagatcgagacggagctgcgcgacatctgcaaggatgtactgctgtct
cttttggaaaagttcttgatccccaatgcttcccaaccagaaagcaaagtcttctatttg
aaaatgaagggtgactactaccgttacttggccgaggttgctgctggtgatgacaagaaa
ggaattgtggaccagtcacagcaagcataccaagaagcatttgaaatcagcaaaaaggag
atgcagccgacacaccccatcagactgggtctggccctcaacttctctgtgttctactac
gagatcctgaactccccagagaaagcctgctctcttgcaaaaacagctttcgatgaagcc
attgctgaacttgatacattaagtgaggagtcctacaaagacagcacgctaataatgcag
ttactgagaaacaacttgacattgtggacatcggatacccaaggagatgaagcagaagca
ggagaaggaggggaaaattaa

KEGG   Mus pahari (shrew mouse): 110318313
Entry
110318313         CDS       T05929                                 

Gene name
Ywhab
Definition
(RefSeq) 14-3-3 protein beta/alpha
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04110  Cell cycle
mpah04114  Oocyte meiosis
mpah04151  PI3K-Akt signaling pathway
mpah04390  Hippo signaling pathway
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110318313 (Ywhab)
   04151 PI3K-Akt signaling pathway
    110318313 (Ywhab)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110318313 (Ywhab)
   04114 Oocyte meiosis
    110318313 (Ywhab)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110318313 (Ywhab)
  09172 Infectious disease: viral
   05161 Hepatitis B
    110318313 (Ywhab)
   05160 Hepatitis C
    110318313 (Ywhab)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mpah03400]
    110318313 (Ywhab)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110318313 (Ywhab)
DNA repair and recombination proteins [BR:mpah03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    110318313 (Ywhab)
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110318313 (Ywhab)
SSDB
Motif
Pfam: 14-3-3 Peptidase_C98 FliM SF3A2
Other DBs
NCBI-GeneID: 110318313
NCBI-ProteinID: XP_021048927
Ensembl: MGP_PahariEiJ_G0026070
LinkDB
Position
3
AA seq 246 aa
MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSS
WRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLILNATQAESKVFY
LKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFY
YEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGD
AGEGEN
NT seq 741 nt   +upstreamnt  +downstreamnt
atgaccatggataagagtgagctggtacagaaagccaaactggctgagcaggctgagcgc
tatgatgacatggctgcagctatgaaagccgtaacagaacagggacacgaactctccaat
gaagagaggaatctactctctgttgcctacaagaacgtggtaggtgcccgccgctcttcc
tggcgtgtcatctccagcatcgaacagaaaaccgagaggaatgagaagaagcagcagatg
ggcaaagagtaccgtgagaagatcgaggccgagctgcaggacatctgcaatgacgtactg
gagctgttggacaaatatctcattctcaatgctacacaggcagaaagcaaagtgttctac
ttaaaaatgaaaggagactattttaggtatctttctgaagttgcatctggagataataaa
caaaccacggtgtcaaactcccagcaggcttaccaagaagcatttgaaatcagcaagaaa
gaaatgcagcccacacacccgattcgccttggcctggcgctgaatttctcagtcttttac
tatgagattctaaactctcctgaaaaggcctgcagcctggccaaaacggcatttgatgag
gcgattgctgaattggataccctgaatgaagagtcttacaaagacagcaccctgatcatg
cagctgcttagggacaatctcaccctgtggacgtcagaaaaccagggggatgaaggagat
gctggagagggagagaactaa

KEGG   Mus pahari (shrew mouse): 110324236
Entry
110324236         CDS       T05929                                 

Gene name
Ywhaq
Definition
(RefSeq) LOW QUALITY PROTEIN: 14-3-3 protein theta
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04110  Cell cycle
mpah04114  Oocyte meiosis
mpah04151  PI3K-Akt signaling pathway
mpah04390  Hippo signaling pathway
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110324236 (Ywhaq)
   04151 PI3K-Akt signaling pathway
    110324236 (Ywhaq)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110324236 (Ywhaq)
   04114 Oocyte meiosis
    110324236 (Ywhaq)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110324236 (Ywhaq)
  09172 Infectious disease: viral
   05161 Hepatitis B
    110324236 (Ywhaq)
   05160 Hepatitis C
    110324236 (Ywhaq)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mpah03400]
    110324236 (Ywhaq)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110324236 (Ywhaq)
DNA repair and recombination proteins [BR:mpah03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    110324236 (Ywhaq)
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110324236 (Ywhaq)
SSDB
Motif
Pfam: 14-3-3 FliM
Other DBs
NCBI-GeneID: 110324236
NCBI-ProteinID: XP_021057284
LinkDB
Position
7
AA seq 236 aa
MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWR
VISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLK
MKGDYFRYLAEVACGDDRKQTIENSQGAYQEAFDISKKEMQPTHPIRLGLALXXXXXYYD
CXLYQAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN
NT seq 711 nt   +upstreamnt  +downstreamnt
atggagaagaccgagctgatccagaaggccaagctggccgagcaggccgagcgctacgac
gacatggccacctgcatgaaagccgtgacggagcagggcgccgagctgtccaacgaggag
cgcaacctgctgtcggtggcctacaagaacgtggtcgggggccgcaggtccgcctggagg
gtcatctcgagcattgagcagaagaccgacacttctgacaagaagttgcagctgatcaag
gactatcgggagaaagtggagtcggagctgaggtccatctgcaccacggtcctggaattg
ttggataagtatttaatagccaatgcaactaatccagagagtaaggtcttctatctgaaa
atgaagggagattatttccggtatcttgctgaagtagcttgtggcgatgatcgaaaacaa
acgatagaaaattcccaaggagcctaccaagaggcatttgatataagcaagaaagagatg
cagcctacgcatccaatccgcctggggctggctcttannnnnnnnnnnncttactatgac
tgttaactttaccaggcttttgatgaggccatcgcagaacttgatacactgaacgaagac
tcgtacaaagacagcaccctcatcatgcagttgcttagagacaacttaacattatggaca
tcggacagtgcaggagaagaatgtgatgcagcagagggggctgaaaactaa

KEGG   Mus pahari (shrew mouse): 110330275
Entry
110330275         CDS       T05929                                 

Gene name
Ywhah
Definition
(RefSeq) 14-3-3 protein eta
  KO
K16198  14-3-3 protein gamma/eta
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04110  Cell cycle
mpah04114  Oocyte meiosis
mpah04151  PI3K-Akt signaling pathway
mpah04390  Hippo signaling pathway
mpah05160  Hepatitis C
mpah05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110330275 (Ywhah)
   04151 PI3K-Akt signaling pathway
    110330275 (Ywhah)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110330275 (Ywhah)
   04114 Oocyte meiosis
    110330275 (Ywhah)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110330275 (Ywhah)
  09172 Infectious disease: viral
   05160 Hepatitis C
    110330275 (Ywhah)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mpah01009]
    110330275 (Ywhah)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mpah03400]
    110330275 (Ywhah)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110330275 (Ywhah)
Protein phosphatases and associated proteins [BR:mpah01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110330275 (Ywhah)
DNA repair and recombination proteins [BR:mpah03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    110330275 (Ywhah)
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110330275 (Ywhah)
SSDB
Motif
Pfam: 14-3-3 CodY
Other DBs
NCBI-GeneID: 110330275
NCBI-ProteinID: XP_021065951
Ensembl: MGP_PahariEiJ_G0016892
LinkDB
Position
13
AA seq 246 aa
MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSW
RVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLALLDKFLIKNCNDFQYESK
VFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEHMQPTHPIRLGLALNFS
VFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDE
EAGEGN
NT seq 741 nt   +upstreamnt  +downstreamnt
atgggggaccgagagcagctgctgcagcgggcgcgactggcggagcaggcggagcgctac
gacgacatggcctccgccatgaaggcggtgacagagctgaatgaaccactatctaatgaa
gatagaaatctcctctctgtggcctacaagaatgtagttggtgccaggcgatcttcttgg
agggtgattagtagcattgagcagaaaaccatggctgatgggaatgagaagaagttggag
aaagttaaagcctaccgggagaagattgagaaagagctggagacagtttgcaatgatgtc
ttggctctgcttgacaagttccttatcaagaactgcaatgattttcagtatgagagcaag
gtgttctacctgaaaatgaagggcgattactaccgctacctggcagaggtggcttctggg
gagaagaaaaacagtgtggttgaagcttctgaggccgcgtataaggaagccttcgaaatc
agcaaagagcacatgcagccaacacaccctatccggcttggcctggccctcaatttttct
gtgttctactatgagatccagaatgcaccagagcaggcctgcctcttagccaaacaagcc
ttcgatgatgctatagctgagctggacacattaaacgaggattcctataaggactccact
ctcatcatgcagttgctgcgagacaacctcaccctctggacgagcgaccagcaggatgaa
gaagctggagaaggcaactga

KEGG   Mus pahari (shrew mouse): 110331575
Entry
110331575         CDS       T05929                                 

Gene name
Ywhae
Definition
(RefSeq) 14-3-3 protein epsilon
  KO
K06630  14-3-3 protein epsilon
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04110  Cell cycle
mpah04114  Oocyte meiosis
mpah04151  PI3K-Akt signaling pathway
mpah04390  Hippo signaling pathway
mpah04621  NOD-like receptor signaling pathway
mpah04722  Neurotrophin signaling pathway
mpah05160  Hepatitis C
mpah05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110331575 (Ywhae)
   04151 PI3K-Akt signaling pathway
    110331575 (Ywhae)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110331575 (Ywhae)
   04114 Oocyte meiosis
    110331575 (Ywhae)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110331575 (Ywhae)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110331575 (Ywhae)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110331575 (Ywhae)
  09172 Infectious disease: viral
   05160 Hepatitis C
    110331575 (Ywhae)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mpah03400]
    110331575 (Ywhae)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110331575 (Ywhae)
DNA repair and recombination proteins [BR:mpah03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    110331575 (Ywhae)
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110331575 (Ywhae)
SSDB
Motif
Pfam: 14-3-3 Orbi_VP5 Ta0938
Other DBs
NCBI-GeneID: 110331575
NCBI-ProteinID: XP_021067966
Ensembl: MGP_PahariEiJ_G0017885
LinkDB
Position
14
AA seq 255 aa
MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASW
RIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVF
YYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVF
YYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGE
EQNKEALQDVEDENQ
NT seq 768 nt   +upstreamnt  +downstreamnt
atggatgatcgggaggatctggtgtaccaggcgaagctggcagagcaggccgagcgatac
gacgaaatggtggaatcaatgaagaaagttgcagggatggacgtggagctgacagttgaa
gaacgaaaccttttatctgttgcatataaaaatgtgattggagccagaagagcatcctgg
agaataatcagcagcattgaacagaaggaagaaaacaaggggggagaggacaaattaaag
atgattcgggagtaccggcaaatggttgaaactgagctcaagttaatctgttgtgacatt
ctggatgtactggacaaacacctcattccagcagctaacactggcgagtccaaggttttc
tattataaaatgaaaggggactaccacaggtatctggctgagtttgccacaggaaatgac
aggaaggaggcagcagagaacagcctcgtggcttacaaagctgctagtgacattgcgatg
acagaacttcctccaacgcaccccattcgtttaggtcttgctctcaacttttccgtattc
tactatgaaattcttaattcccctgaccgtgcctgcaggttggcaaaagcagcttttgat
gacgcaattgcagaactggatacgctgagtgaagaaagctataaggactctacgctcatc
atgcagctgctacgtgataacctgacgctgtggacctcagacatgcagggcgatggtgaa
gagcagaataaagaagcgctgcaggatgtggaagatgagaatcagtga

DBGET integrated database retrieval system