KEGG   Mus pahari (shrew mouse): 110312794
Entry
110312794         CDS       T05929                                 

Gene name
Ppp1cc
Definition
(RefSeq) serine/threonine-protein phosphatase PP1-gamma catalytic subunit
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah03015  mRNA surveillance pathway
mpah04022  cGMP-PKG signaling pathway
mpah04024  cAMP signaling pathway
mpah04114  Oocyte meiosis
mpah04218  Cellular senescence
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04270  Vascular smooth muscle contraction
mpah04390  Hippo signaling pathway
mpah04510  Focal adhesion
mpah04611  Platelet activation
mpah04720  Long-term potentiation
mpah04728  Dopaminergic synapse
mpah04750  Inflammatory mediator regulation of TRP channels
mpah04810  Regulation of actin cytoskeleton
mpah04910  Insulin signaling pathway
mpah04921  Oxytocin signaling pathway
mpah04931  Insulin resistance
mpah05031  Amphetamine addiction
mpah05034  Alcoholism
mpah05168  Herpes simplex virus 1 infection
mpah05205  Proteoglycans in cancer
mpah05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    110312794 (Ppp1cc)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110312794 (Ppp1cc)
   04024 cAMP signaling pathway
    110312794 (Ppp1cc)
   04022 cGMP-PKG signaling pathway
    110312794 (Ppp1cc)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110312794 (Ppp1cc)
   04218 Cellular senescence
    110312794 (Ppp1cc)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110312794 (Ppp1cc)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110312794 (Ppp1cc)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110312794 (Ppp1cc)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110312794 (Ppp1cc)
   04921 Oxytocin signaling pathway
    110312794 (Ppp1cc)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110312794 (Ppp1cc)
   04270 Vascular smooth muscle contraction
    110312794 (Ppp1cc)
  09156 Nervous system
   04728 Dopaminergic synapse
    110312794 (Ppp1cc)
   04720 Long-term potentiation
    110312794 (Ppp1cc)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110312794 (Ppp1cc)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    110312794 (Ppp1cc)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    110312794 (Ppp1cc)
  09165 Substance dependence
   05031 Amphetamine addiction
    110312794 (Ppp1cc)
   05034 Alcoholism
    110312794 (Ppp1cc)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    110312794 (Ppp1cc)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    110312794 (Ppp1cc)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mpah01009]
    110312794 (Ppp1cc)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mpah03021]
    110312794 (Ppp1cc)
   03019 Messenger RNA biogenesis [BR:mpah03019]
    110312794 (Ppp1cc)
   03041 Spliceosome [BR:mpah03041]
    110312794 (Ppp1cc)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     110312794 (Ppp1cc)
Protein phosphatases and associated proteins [BR:mpah01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     110312794 (Ppp1cc)
Transcription machinery [BR:mpah03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     110312794 (Ppp1cc)
Messenger RNA biogenesis [BR:mpah03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     110312794 (Ppp1cc)
Spliceosome [BR:mpah03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    110312794 (Ppp1cc)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 110312794
NCBI-ProteinID: XP_021042339
Ensembl: MGP_PahariEiJ_G0024278
LinkDB
Position
23
AA seq 323 aa
MADIDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
KKKPNATRPVTPPRGMITKQAKK
NT seq 972 nt   +upstreamnt  +downstreamnt
atggcggatatcgataaactcaacatcgacagcatcatccaacggctgctggaagtgaga
gggtccaagccaggcaagaatgtccagctccaggagaacgaaatccgaggactctgcctg
aagtctcgggagatcttcctcagtcagcctatccttttagaacttgaagcaccactcaag
atatgtggtgacatccacgggcagtactatgatttgctccgtctgtttgagtacggtggc
ttccctccagagagcaactatttgtttctcggggactatgtggacaggggcaaacagtca
ctagagacgatctgcctcttgctggcctacaaaatcaagtatccagagaacttttttctt
ctcagagggaaccatgagtgtgccagcatcaatagaatctatggattttatgatgagtgt
aaaagaagatacaacattaagctgtggaaaacgttcacagactgttttaactgcttaccg
atagcagccatcgtggacgagaagatattctgctgtcatggaggtttatcaccagatctt
caatctatggagcagattcggcgaattatgagaccaactgatgtaccagatcaaggtctt
ctttgtgatcttttgtggtctgaccccgataaagatgtcttaggctggggtgaaaatgac
agaggagtgtccttcacatttggtgcagaagtggttgcaaaatttctccataagcatgat
ttggatcttatatgtagagcccatcaggtggttgaagatggctatgagttttttgcaaag
aggcagttagtcactctgttttctgcacccaactactgtggcgagtttgacaatgcaggt
gccatgatgagtgtggatgagaccctcatgtgttccttccagattttaaagcctgcagag
aaaaagaagcccaacgccacgagacctgtcacaccgccacggggtatgatcacaaagcaa
gcaaagaaatag

KEGG   Mus pahari (shrew mouse): 110317198
Entry
110317198         CDS       T05929                                 

Gene name
Ppp1ca
Definition
(RefSeq) serine/threonine-protein phosphatase PP1-alpha catalytic subunit isoform X1
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah03015  mRNA surveillance pathway
mpah04022  cGMP-PKG signaling pathway
mpah04024  cAMP signaling pathway
mpah04114  Oocyte meiosis
mpah04218  Cellular senescence
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04270  Vascular smooth muscle contraction
mpah04390  Hippo signaling pathway
mpah04510  Focal adhesion
mpah04611  Platelet activation
mpah04720  Long-term potentiation
mpah04728  Dopaminergic synapse
mpah04750  Inflammatory mediator regulation of TRP channels
mpah04810  Regulation of actin cytoskeleton
mpah04910  Insulin signaling pathway
mpah04921  Oxytocin signaling pathway
mpah04931  Insulin resistance
mpah05031  Amphetamine addiction
mpah05034  Alcoholism
mpah05168  Herpes simplex virus 1 infection
mpah05205  Proteoglycans in cancer
mpah05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    110317198 (Ppp1ca)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110317198 (Ppp1ca)
   04024 cAMP signaling pathway
    110317198 (Ppp1ca)
   04022 cGMP-PKG signaling pathway
    110317198 (Ppp1ca)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110317198 (Ppp1ca)
   04218 Cellular senescence
    110317198 (Ppp1ca)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110317198 (Ppp1ca)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110317198 (Ppp1ca)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110317198 (Ppp1ca)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110317198 (Ppp1ca)
   04921 Oxytocin signaling pathway
    110317198 (Ppp1ca)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110317198 (Ppp1ca)
   04270 Vascular smooth muscle contraction
    110317198 (Ppp1ca)
  09156 Nervous system
   04728 Dopaminergic synapse
    110317198 (Ppp1ca)
   04720 Long-term potentiation
    110317198 (Ppp1ca)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110317198 (Ppp1ca)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    110317198 (Ppp1ca)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    110317198 (Ppp1ca)
  09165 Substance dependence
   05031 Amphetamine addiction
    110317198 (Ppp1ca)
   05034 Alcoholism
    110317198 (Ppp1ca)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    110317198 (Ppp1ca)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    110317198 (Ppp1ca)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mpah01009]
    110317198 (Ppp1ca)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mpah03021]
    110317198 (Ppp1ca)
   03019 Messenger RNA biogenesis [BR:mpah03019]
    110317198 (Ppp1ca)
   03041 Spliceosome [BR:mpah03041]
    110317198 (Ppp1ca)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     110317198 (Ppp1ca)
Protein phosphatases and associated proteins [BR:mpah01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     110317198 (Ppp1ca)
Transcription machinery [BR:mpah03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     110317198 (Ppp1ca)
Messenger RNA biogenesis [BR:mpah03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     110317198 (Ppp1ca)
Spliceosome [BR:mpah03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    110317198 (Ppp1ca)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 110317198
NCBI-ProteinID: XP_021047281
Ensembl: MGP_PahariEiJ_G0013994
LinkDB
Position
1
AA seq 339 aa
MSDSEKLNLDSIIGRLLEGSQDPIPYPVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPI
LLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYK
IKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFC
CHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEV
VAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMC
SFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgtccgacagcgagaagctcaacctggactccatcatcgggcgcctgctggaagggtcc
caagaccctattccatacccagtgcagggctcacggcctggaaagaatgtgcagctgaca
gagaacgagatccgtggtctgtgcctcaaatcccgggagattttcctgagccagcctatt
cttctggagcttgaggcgcctctcaagatctgtggtgacatccatggccagtactatgac
cttctacggctgtttgagtatggtggcttccctccagagagcaactacctcttcttgggg
gattatgtagatcggggcaagcagtctttggagaccatctgcctgttgctggcctataag
atcaaatacccggagaatttctttctacttcgtgggaaccatgagtgtgccagcatcaac
cgcatctatggcttctatgatgaatgcaagagaagatacaacatcaagctgtggaagacg
ttcactgactgcttcaactgcctgcccattgcagccattgtggatgagaagatcttctgc
tgccatgggggcctgtctccagacttgcaatccatggagcagattaggcgtatcatgcgg
cccacagacgtgcctgaccagggcctgctgtgtgatctcctgtggtctgaccctgacaag
gatgttcagggctggggcgagaatgaccgtggcgtgtcctttacctttggggcggaggtg
gtagccaagttcctgcacaagcatgatctggacctcatctgcagagcgcatcaggtcgta
gaagatggctacgagttctttgccaagagacagttggtgacactgttctcagctcccaac
tactgtggagagtttgacaacgctggtgccatgatgagtgtggacgagaccctcatgtgc
tccttccagatcctcaagcccgctgataagaataagggcaagtatgggcagttcagcggc
ctgaaccccggaggccggcccatcaccccaccccgcaattctgccaaagccaagaagtag

KEGG   Mus pahari (shrew mouse): 110324329
Entry
110324329         CDS       T05929                                 

Gene name
Ppp1cb
Definition
(RefSeq) serine/threonine-protein phosphatase PP1-beta catalytic subunit
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah03015  mRNA surveillance pathway
mpah04022  cGMP-PKG signaling pathway
mpah04024  cAMP signaling pathway
mpah04114  Oocyte meiosis
mpah04218  Cellular senescence
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04270  Vascular smooth muscle contraction
mpah04390  Hippo signaling pathway
mpah04510  Focal adhesion
mpah04611  Platelet activation
mpah04720  Long-term potentiation
mpah04728  Dopaminergic synapse
mpah04750  Inflammatory mediator regulation of TRP channels
mpah04810  Regulation of actin cytoskeleton
mpah04910  Insulin signaling pathway
mpah04921  Oxytocin signaling pathway
mpah04931  Insulin resistance
mpah05031  Amphetamine addiction
mpah05034  Alcoholism
mpah05168  Herpes simplex virus 1 infection
mpah05205  Proteoglycans in cancer
mpah05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    110324329 (Ppp1cb)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110324329 (Ppp1cb)
   04024 cAMP signaling pathway
    110324329 (Ppp1cb)
   04022 cGMP-PKG signaling pathway
    110324329 (Ppp1cb)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110324329 (Ppp1cb)
   04218 Cellular senescence
    110324329 (Ppp1cb)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110324329 (Ppp1cb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110324329 (Ppp1cb)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110324329 (Ppp1cb)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110324329 (Ppp1cb)
   04921 Oxytocin signaling pathway
    110324329 (Ppp1cb)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110324329 (Ppp1cb)
   04270 Vascular smooth muscle contraction
    110324329 (Ppp1cb)
  09156 Nervous system
   04728 Dopaminergic synapse
    110324329 (Ppp1cb)
   04720 Long-term potentiation
    110324329 (Ppp1cb)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110324329 (Ppp1cb)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    110324329 (Ppp1cb)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    110324329 (Ppp1cb)
  09165 Substance dependence
   05031 Amphetamine addiction
    110324329 (Ppp1cb)
   05034 Alcoholism
    110324329 (Ppp1cb)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    110324329 (Ppp1cb)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    110324329 (Ppp1cb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mpah01009]
    110324329 (Ppp1cb)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mpah03021]
    110324329 (Ppp1cb)
   03019 Messenger RNA biogenesis [BR:mpah03019]
    110324329 (Ppp1cb)
   03041 Spliceosome [BR:mpah03041]
    110324329 (Ppp1cb)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     110324329 (Ppp1cb)
Protein phosphatases and associated proteins [BR:mpah01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     110324329 (Ppp1cb)
Transcription machinery [BR:mpah03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     110324329 (Ppp1cb)
Messenger RNA biogenesis [BR:mpah03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     110324329 (Ppp1cb)
Spliceosome [BR:mpah03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    110324329 (Ppp1cb)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 110324329
NCBI-ProteinID: XP_021057474
Ensembl: MGP_PahariEiJ_G0029278
LinkDB
Position
7
AA seq 327 aa
MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKI
CGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLL
RGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQ
SMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDL
DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEK
KAKYQYGGLNSGRPVTPPRTANPPKKR
NT seq 984 nt   +upstreamnt  +downstreamnt
atggcggacggggagctgaacgtggacagcctcatcacccgcctgctggaggtacgagga
tgtcgtccaggaaagattgtgcaaatgactgaagcagaagtccgagggttgtgtatcaag
tctcgtgaaatctttctcagccagcctattcttttggaattggaagcaccactgaagatt
tgtggagacattcatggacaatatacagacttactaagattatttgaatatggaggtttt
ccaccagaagccaactatcttttcttaggagattatgtggacagagggaagcagtctttg
gaaaccatctgtttgctattggcttacaaaatcaaatacccggagaacttctttcttcta
agaggaaaccatgagtgtgctagcatcaatcgcatttatggattctacgatgagtgtaaa
cgaagatttaatattaaattgtggaagacattcactgattgttttaactgtctgcctata
gctgctattgttgatgagaaaatcttctgttgtcatggaggactgtcaccagacctacaa
tctatggaacagattcggagaattatgagacccactgacgtacctgatacaggtttgctt
tgtgacttactgtggtctgacccagataaggatgtacaaggctggggagaaaatgaccgt
ggtgtttcttttacttttggagctgatgtagtcagtaaatttctgaatcgtcatgattta
gacttgatttgtcgagctcatcaggtggtagaagatggatatgaattttttgctaaacga
caattggtaactttattttctgccccaaattactgcggcgagtttgacaatgctggtggt
atgatgagtgtggatgaaactttgatgtgttcattccagatattgaaaccatctgaaaag
aaagctaagtaccagtatggtgggctgaattctggacgtcctgtcactccaccccgaaca
gctaatccaccgaagaaaaggtga

DBGET integrated database retrieval system