KEGG   Mus pahari (shrew mouse): 110312856
Entry
110312856         CDS       T05929                                 

Gene name
Fzd9
Definition
(RefSeq) frizzled-9
  KO
K02842  frizzled 9/10
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04150  mTOR signaling pathway
mpah04310  Wnt signaling pathway
mpah04390  Hippo signaling pathway
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04916  Melanogenesis
mpah04934  Cushing syndrome
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05165  Human papillomavirus infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05217  Basal cell carcinoma
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110312856 (Fzd9)
   04390 Hippo signaling pathway
    110312856 (Fzd9)
   04150 mTOR signaling pathway
    110312856 (Fzd9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110312856 (Fzd9)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110312856 (Fzd9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110312856 (Fzd9)
   05205 Proteoglycans in cancer
    110312856 (Fzd9)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110312856 (Fzd9)
   05226 Gastric cancer
    110312856 (Fzd9)
   05217 Basal cell carcinoma
    110312856 (Fzd9)
   05224 Breast cancer
    110312856 (Fzd9)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110312856 (Fzd9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110312856 (Fzd9)
   05022 Pathways of neurodegeneration - multiple diseases
    110312856 (Fzd9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110312856 (Fzd9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mpah04030]
    110312856 (Fzd9)
   04090 CD molecules [BR:mpah04090]
    110312856 (Fzd9)
G protein-coupled receptors [BR:mpah04030]
 Frizzled / Smoothened family
  110312856 (Fzd9)
CD molecules [BR:mpah04090]
 Proteins
  110312856 (Fzd9)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 110312856
NCBI-ProteinID: XP_021042437
Ensembl: MGP_PahariEiJ_G0024412
LinkDB
Position
23
AA seq 592 aa
MAVPPLLRGALLLWQLLATGGAALEIGRFDPERGRGPAPCQAMEIPMCRGIGYNLTRMPN
LLGHTSQGEAAAQLAEFSPLVQYGCHSHLRFFLCSLYAPMCTDQVSTPIPACRPMCEQAR
LRCAPIMEQFNFGWPDSLDCARLPTRNDPHALCMEAPENATAGPTEPHKGLGMLPVAPRP
ARPPGDSAPGPGSGGTCDNPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDFALVWMAVWS
ALCFFSTAFTVFTFLLEPHRFQYPERPIIFLSMCYNVYSLAFLIRAVAGAQSVACDQEAG
ALYVIQEGLENTGCTLVFLLLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFH
MAAWGLPALKTIVVLTLRKVAGDELTGLCYVASMDPAALTGFVLVPLSCYLVLGTSFLLT
GFVALFHIRKIMKTGGTNTEKLEKLMVKIGVFSILYTVPATCVIVCYVYERLNMDFWRLR
ATEQPCTAATVPGGRRDCSLPGGSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTFQTWQS
LCYRKMAAGRARAKACRTPGGYGRGTHCHYKAPTVVLHMTKTDPSLENPTHL
NT seq 1779 nt   +upstreamnt  +downstreamnt
atggccgtgccaccgctgctccgcggagcgctgcttctgtggcagctgctggcgacgggc
ggcgcggcgctggagatcggccgcttcgatccggagcgcggccgtggccccgcaccgtgc
caagcgatggagatccccatgtgccggggcatcggctacaacctgacccgcatgcccaac
ctactgggccacacgtcgcagggcgaggcggccgcgcagctggccgagttctcgcccctc
gtgcagtacggctgccacagccacctgcgcttcttcctctgctcgctttacgccccaatg
tgcaccgaccaggtctccactcccatccccgcctgccggcccatgtgcgagcaggctcgc
ctgcgctgcgcccccatcatggagcaattcaatttcggctggccggactcactcgactgt
gcccggctccccacgcgcaacgacccgcacgcgctctgcatggaggcaccggagaacgct
accgcaggccccacagaaccccacaagggcctgggcatgctccctgtggcacctcggccc
gcgaggccaccgggagattcagccccaggtcccggcagcggtggcacctgcgacaacccg
gagaagttccagtacgtggagaagagtcgctcgtgcgctccgcgctgcgggccaggcgtc
gaggtgttctggtctcggcgcgataaggacttcgctctggtctggatggctgtgtggtcc
gcgttgtgtttcttctccacggccttcaccgtgttcaccttcctgctggagcctcaccgg
ttccagtacccagagcgcccgattatcttcctttccatgtgctacaatgtctactccttg
gcctttctgatcagagcggtggcaggtgcacagagtgtggcatgcgaccaggaggcaggg
gctctgtatgtgatccaggagggtctggaaaacacaggctgcaccctggtcttcctattg
ctctattatttcgggatggccagctcactttggtgggtggttttgactctcacctggttc
ctggctgcaggcaaaaaatggggccacgaggccatcgaggctcacggtagctacttccac
atggcagcctggggcctgccagcgctcaagacgatcgtggtcctgactctgcgaaaggtg
gctggggatgaactgactggactctgctatgtagccagcatggacccggcagccctcact
ggctttgttttggtacccctctcttgctacctggtactgggcaccagtttcctcttgacc
ggttttgtggccctcttccatatccgcaaaatcatgaagacgggcggcaccaatacagag
aagctggagaagctgatggtcaaaatcggagtcttttccatcctttacacagtgccggcc
acctgtgtcattgtctgctacgtttacgaacgcctcaacatggacttctggcggcttcgg
gccacagagcaaccatgtactgctgccaccgtgcctggaggccggagagactgttcgctg
ccagggggctcggtgcccactgtggctgtcttcatgctcaaaatcttcatgtccttggtg
gtgggcatcaccagtggagtctgggtatggagttccaagacttttcagacttggcagagc
ctgtgctaccgaaaaatggcagctggccgagcccgtgccaaggcctgccgaaccccaggg
ggctatggccggggtacccattgccactacaaagcccccacggtggtcttgcacatgact
aagacagacccttctctggagaaccccacacacctctag

KEGG   Mus pahari (shrew mouse): 110316646
Entry
110316646         CDS       T05929                                 

Gene name
Fzd1
Definition
(RefSeq) frizzled-1
  KO
K02432  frizzled 1/7
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04150  mTOR signaling pathway
mpah04310  Wnt signaling pathway
mpah04390  Hippo signaling pathway
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04916  Melanogenesis
mpah04934  Cushing syndrome
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05165  Human papillomavirus infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05217  Basal cell carcinoma
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110316646 (Fzd1)
   04390 Hippo signaling pathway
    110316646 (Fzd1)
   04150 mTOR signaling pathway
    110316646 (Fzd1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110316646 (Fzd1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110316646 (Fzd1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110316646 (Fzd1)
   05205 Proteoglycans in cancer
    110316646 (Fzd1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110316646 (Fzd1)
   05226 Gastric cancer
    110316646 (Fzd1)
   05217 Basal cell carcinoma
    110316646 (Fzd1)
   05224 Breast cancer
    110316646 (Fzd1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110316646 (Fzd1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110316646 (Fzd1)
   05022 Pathways of neurodegeneration - multiple diseases
    110316646 (Fzd1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110316646 (Fzd1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mpah04030]
    110316646 (Fzd1)
G protein-coupled receptors [BR:mpah04030]
 Frizzled / Smoothened family
  110316646 (Fzd1)
SSDB
Motif
Pfam: Frizzled Fz 7tm_2 Dicty_CAR
Other DBs
NCBI-GeneID: 110316646
NCBI-ProteinID: XP_021046731
Ensembl: MGP_PahariEiJ_G0021716
LinkDB
Position
2
AA seq 642 aa
MAEEAAPSESRAAGRLSLELCAGALPGRREEVGHRDTASHRRPRADPRRWASGLLLLLWL
LEAPLLLGVRAQAAGQVSGPGQQAPPPPQPQQSGQQYNGERGISIPDHGYCQPISIPLCT
DIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQALP
PCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTPSLLPE
FWTSNPQHGGGGYRGGYPGGAGTVERGKFSCPRALRVPSYLNYHFLGEKDCGAPCEPTKV
YGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYTAV
AVAYIAGFLLEDRVVCNDKFAEDGARTVAQGTKKEGCTILFMMLYFFSMASSIWWVILSL
TWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGVCFVGLNNVD
ALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYT
VPATIVIACYFYEQAFRDQWERSWVAQSCKSYAIPCPHLQGGGGVPPHPPMSPDFTVFMI
KYLMTLIVGITSGFWIWSGKTLNSWRKFYTRLTNSKQGETTV
NT seq 1929 nt   +upstreamnt  +downstreamnt
atggctgaggaggcggcgcctagcgagtcccgggccgccggccggctgagcttggaactt
tgtgccggagcactcccgggccggcgggaggaggtggggcacagggacacggccagccac
cgccgcccccgggctgatccccggcgctgggctagcgggctgctgctgctgctttggctg
ctggaggctcctctgcttttgggggtccgagcgcaggcggcgggccaggtatccgggccg
ggccagcaagccccgccgccgccccagccccagcagagcgggcagcagtacaacggcgaa
cggggcatctccatcccggaccacggctactgccagcccatctccatcccgctgtgcacg
gacatcgcgtacaaccagaccatcatgcccaacctgctgggccacacgaatcaggaggac
gccggtctggaggtgcaccagttctacccgctggtgaaggtgcagtgctccgccgagctc
aagttcttcctgtgctccatgtacgcgcctgtgtgcaccgtactggagcaggcgctgccg
ccctgccgctccctgtgcgagcgcgcacgccagggctgcgaggcgctcatgaacaagttc
ggcttccagtggccagacacgctcaagtgcgagaagttcccggtgcacggcgcaggagag
ctgtgcgtgggccagaacacgtccgacaaaggcaccccaactccctccttgctgccggag
ttctggaccagcaatccgcagcacggcggcggtggttaccgcggcggctacccggggggt
gccgggacggtggagcggggaaagttctcctgcccgcgcgccctcagggtgccctcctac
ctcaactaccactttctgggggagaaggactgtggcgcaccctgcgaacccaccaaggta
tacgggctcatgtacttcgggcccgaggagctgcgcttctcgcgcacctggataggcatc
tggtccgtgctgtgctgcgcctccacgctcttcacggtgctcacgtacctagtggacatg
aggcgcttcagctacccggaacggcccatcattttcctgtccggctgttacacagcggtg
gcggtggcctacatcgccggctttctcttggaggaccgggtggtgtgtaatgacaagttt
gcagaggacggggcgcgcacggtggcgcagggcactaagaaagaaggctgcactatactc
tttatgatgctctacttcttcagtatggccagctccatctggtgggtaatcctgtccctc
acctggttcctggcagccggcatgaagtggggccacgaagccatcgaggccaactcacag
tatttccacctagccgcctgggctgtgccagccatcaaaactataaccatcttggcgttg
ggccaggtggatggcgacgtactgagcggagtgtgttttgtggggctcaacaacgtggac
gcgctgcgtggctttgtgctggcgcctctcttcgtttatctgttcatcggcacctctttc
ctgctggccggtttcgtgtcactcttccgcatccgcaccatcatgaagcatgacggcacc
aagacagagaagctggagaagctgatggtgcgcatcggagtcttcagtgtgctctacacc
gtgccggccaccatcgtcatcgcctgctacttctatgaacaggcctttcgggaccagtgg
gagcgcagctgggtggcccagagctgcaagagttatgccatcccttgccctcacctccag
ggaggtggaggtgtcccaccacacccgcccatgagccccgactttacagtcttcatgatc
aagtatctcatgacgctgattgtgggcatcacatcgggcttctggatctggtctggcaag
acactgaattcctggaggaagttctacacgaggcttaccaacagcaaacagggggagact
accgtctga

KEGG   Mus pahari (shrew mouse): 110321741
Entry
110321741         CDS       T05929                                 

Gene name
Fzd5
Definition
(RefSeq) frizzled-5
  KO
K02375  frizzled 5/8
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04150  mTOR signaling pathway
mpah04310  Wnt signaling pathway
mpah04390  Hippo signaling pathway
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04916  Melanogenesis
mpah04934  Cushing syndrome
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05165  Human papillomavirus infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05217  Basal cell carcinoma
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110321741 (Fzd5)
   04390 Hippo signaling pathway
    110321741 (Fzd5)
   04150 mTOR signaling pathway
    110321741 (Fzd5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110321741 (Fzd5)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110321741 (Fzd5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110321741 (Fzd5)
   05205 Proteoglycans in cancer
    110321741 (Fzd5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110321741 (Fzd5)
   05226 Gastric cancer
    110321741 (Fzd5)
   05217 Basal cell carcinoma
    110321741 (Fzd5)
   05224 Breast cancer
    110321741 (Fzd5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110321741 (Fzd5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110321741 (Fzd5)
   05022 Pathways of neurodegeneration - multiple diseases
    110321741 (Fzd5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110321741 (Fzd5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mpah04030]
    110321741 (Fzd5)
G protein-coupled receptors [BR:mpah04030]
 Frizzled / Smoothened family
  110321741 (Fzd5)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 110321741
NCBI-ProteinID: XP_021053853
Ensembl: MGP_PahariEiJ_G0027448
LinkDB
Position
5
AA seq 585 aa
MARPDPSAPPSLLLLLLAQLVGRAAAASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQ
DEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLM
RQYGFAWPERMSCDRLPVLGGDAEVLCMDYNRSEATTASPKSFPAKPTLPGPPGAPSSGG
ECPSGGPSVCTCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSPDERTFATFWIG
LWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSR
EHSHIHYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYF
HLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLL
AGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEA
ALTCACPGPDAGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTLESWRRFTSRCCCS
SRRGHKSGGAMAAGDYAEASAALTGRTGPPGPTAAYHKQVSLSHV
NT seq 1758 nt   +upstreamnt  +downstreamnt
atggctcgacccgacccgtctgcgcctccctctcttctgctgctgttgctggctcagctg
gtgggccgggcagcggccgcctccaaggccccggtgtgccaggaaatcacggtgcccatg
tgccgcggcatcggctacaacctgacgcacatgcccaaccagttcaaccatgacacgcag
gacgaagcgggcctggaggtgcaccaattctggccgctggtggagatccactgctccccg
gacctgcgcttcttcctgtgctccatgtacacgcccatctgtttgcctgactaccacaag
ccgctaccaccgtgccgctccgtgtgcgagcgcgccaaggccggctgctcgccgctcatg
cgccagtacggcttcgcctggcccgagcgcatgagctgtgaccgcctccctgtgctgggc
ggcgacgccgaggttctgtgcatggattataaccgaagcgaagccaccaccgcgtccccc
aagtccttcccagccaagcctactctcccaggaccaccaggggcgccatcttccgggggc
gagtgcccctcgggaggcccatctgtgtgcacgtgccgcgagcccttcgtgcccatcctg
aaggagtcacacccactctacaacaaggtgcgcaccggccaagtgcccaactgcgcggtg
ccctgctaccagccgtccttcagcccggatgagcgcacgttcgccaccttctggattggc
ctgtggtctgtgctgtgcttcatctccacgtccaccaccgtcgccaccttcctcattgac
atggaacgattccgctaccctgagcgccccatcatcttcttgtctgcgtgctacctgtgt
gtgtccctgggattcttggtgcgcctggtcgtgggccatgccagcgtcgcctgcagccgt
gagcacagccacattcactatgagactaccggccctgcgctgtgcacggttgtcttcctc
ttagtctacttctttggcatggccagctccatctggtgggtcatcctgtcgctcacctgg
ttcttggcggctggcatgaagtggggcaatgaagccatcgcaggctatgcacagtacttc
caccttgctgcctggctcatccccagcgtcaagtccattacggcgctggcactgagctcg
gtggacggggacccagtggctggcatctgctacgtgggcaaccaaaacctgaactcacta
cgaggctttgtcttgggcccactggtgctgtacctgttggtgggcacgctcttccttctg
gcaggcttcgtgtcactcttccgcatccggagcgtcatcaagcagggtggcactaagacg
gacaagctggagaagctcatgatccgcatcggcatcttcaccctgctctacacggtgcca
gccagcatcgtggtggcctgctacctgtatgagcagcactaccgggagagctgggaggca
gccctcacctgtgcgtgtccaggcccggacgctggccagccacgcgccaaacccgagtac
tgggtgctcatgctcaagtacttcatgtgcctggtggtgggcatcacgtcgggagtctgg
atctggtccggcaagaccctggagtcttggcggcggttcaccagccgctgctgctgcagc
tctcggcggggccacaagagcggtggcgctatggccgcaggagactatgcggaggccagc
gccgcgctcaccggcaggaccgggccgcctggacccaccgccgcataccacaagcaagtg
tcactgtcgcacgtatag

KEGG   Mus pahari (shrew mouse): 110321753
Entry
110321753         CDS       T05929                                 

Gene name
Fzd7
Definition
(RefSeq) frizzled-7
  KO
K02432  frizzled 1/7
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04150  mTOR signaling pathway
mpah04310  Wnt signaling pathway
mpah04390  Hippo signaling pathway
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04916  Melanogenesis
mpah04934  Cushing syndrome
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05165  Human papillomavirus infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05217  Basal cell carcinoma
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110321753 (Fzd7)
   04390 Hippo signaling pathway
    110321753 (Fzd7)
   04150 mTOR signaling pathway
    110321753 (Fzd7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110321753 (Fzd7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110321753 (Fzd7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110321753 (Fzd7)
   05205 Proteoglycans in cancer
    110321753 (Fzd7)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110321753 (Fzd7)
   05226 Gastric cancer
    110321753 (Fzd7)
   05217 Basal cell carcinoma
    110321753 (Fzd7)
   05224 Breast cancer
    110321753 (Fzd7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110321753 (Fzd7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110321753 (Fzd7)
   05022 Pathways of neurodegeneration - multiple diseases
    110321753 (Fzd7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110321753 (Fzd7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mpah04030]
    110321753 (Fzd7)
G protein-coupled receptors [BR:mpah04030]
 Frizzled / Smoothened family
  110321753 (Fzd7)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR DUF6338
Other DBs
NCBI-GeneID: 110321753
NCBI-ProteinID: XP_021053875
Ensembl: MGP_PahariEiJ_G0027416
LinkDB
Position
5
AA seq 572 aa
MRGPGTAASHSPLGLCALVLALLGALPTDTRAQPYHGEKGISVPDHGFCQPISIPLCTDI
AYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPC
RSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGAGGSPTAYP
TAPYLPDPPFTAMSPSDGRGRWSFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRANGL
MYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVAVA
HVAGFLLEDRAVCVERFSDDGYRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLTWF
LAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDALR
GFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTVPA
TIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGHFSPMSPDFTVFMIKYLMTMIVGI
TTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV
NT seq 1719 nt   +upstreamnt  +downstreamnt
atgcggggccccggcacggcggcgtcgcattcgcccctgggcctctgcgccctggtgctt
gctcttctgggcgcgttgcccacggacacccgggctcaaccataccacggcgagaaaggc
atctcggtaccagaccacggcttctgccaacccatctccatcccgttgtgcacggatatc
gcctacaaccagaccatcctgcccaacctgctgggccacacgaaccaagaggacgcgggc
ctcgaggtgcaccagttctaccctctggtaaaggtgcaatgttctcccgagctgcgcttc
ttcttatgctctatgtacgcacccgtgtgcaccgtgctcgaccaagccattcctccgtgc
cgttccttgtgcgagcgcgcccgacagggctgcgaggcgctcatgaacaagttcggcttc
cagtggccggagcggttgcgctgcgagaacttcccagtgcacggcgccggcgagatatgc
gtggggcagaacacgtccgacggttccgggggcgcggggggcagtcccaccgcctaccct
actgctccctacctgccagacccacctttcactgcgatgtccccttcagatggcagaggc
cgctggtctttccccttctcgtgcccgcgccagctcaaggtgcccccctacctgggctac
cgcttcctaggtgagcgtgactgcggtgccccgtgtgagccgggccgtgctaatggactc
atgtactttaaagaagaggagagacggttcgcccgcctttgggtgggtgtgtggtcagtg
ctgtgctgcgcctcgacgctcttcacggtgctcacttacctagtggacatgcgtcgcttc
agctatccagagcgacccatcatcttcctgtcgggttgctacttcatggtggcagtggcg
cacgtggcgggcttcctgctagaggaccgtgccgtgtgcgtggagcgcttctcggacgat
ggctaccgcacggtggcgcagggcaccaagaaggagggctgcaccatcctcttcatggtg
ctttacttcttcggtatggccagctccatctggtgggtcattctgtccctcacttggttc
ctggcagctggcatgaagtggggccacgaggccatcgaggccaactcgcagtactttcat
ctggccgcgtgggctgtgccagcggtcaagacaatcaccatcttggccatgggccaggtg
gatggtgacctactcagtggagtgtgctacgtgggcctgtctagtgtggatgcgttgcgg
ggcttcgtgctggcgcccttgttcgtctacctcttcatcgggacgtccttcctgttggcc
ggctttgtgtctctctttcgcatccgcaccatcatgaagcacgacggcaccaagacggag
aagctggagaagctgatggtgcgcatcggcgtcttcagcgtgctctacacggtgccggcc
accatcgtgctggcctgctacttttacgagcaggccttccgcgagcactgggaacgcacc
tggctcctgcagacctgcaagagctacgctgtgccctgccctccgggccacttctcgccc
atgagccccgactttacagtcttcatgatcaagtacctgatgaccatgatcgtgggcatc
actacgggcttctggatctggtcgggcaagaccctgcagtcatggcgtcgcttctaccac
agactcagccacagtagcaagggggagactgcggtatga

KEGG   Mus pahari (shrew mouse): 110325524
Entry
110325524         CDS       T05929                                 

Gene name
Fzd3
Definition
(RefSeq) frizzled-3
  KO
K02329  frizzled 3
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04150  mTOR signaling pathway
mpah04310  Wnt signaling pathway
mpah04360  Axon guidance
mpah04390  Hippo signaling pathway
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04916  Melanogenesis
mpah04934  Cushing syndrome
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05165  Human papillomavirus infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05206  MicroRNAs in cancer
mpah05217  Basal cell carcinoma
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110325524 (Fzd3)
   04390 Hippo signaling pathway
    110325524 (Fzd3)
   04150 mTOR signaling pathway
    110325524 (Fzd3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110325524 (Fzd3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110325524 (Fzd3)
  09158 Development and regeneration
   04360 Axon guidance
    110325524 (Fzd3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110325524 (Fzd3)
   05206 MicroRNAs in cancer
    110325524 (Fzd3)
   05205 Proteoglycans in cancer
    110325524 (Fzd3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110325524 (Fzd3)
   05226 Gastric cancer
    110325524 (Fzd3)
   05217 Basal cell carcinoma
    110325524 (Fzd3)
   05224 Breast cancer
    110325524 (Fzd3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110325524 (Fzd3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110325524 (Fzd3)
   05022 Pathways of neurodegeneration - multiple diseases
    110325524 (Fzd3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110325524 (Fzd3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mpah04030]
    110325524 (Fzd3)
G protein-coupled receptors [BR:mpah04030]
 Frizzled / Smoothened family
  110325524 (Fzd3)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 110325524
NCBI-ProteinID: XP_021059221
Ensembl: MGP_PahariEiJ_G0030439
LinkDB
Position
8
AA seq 666 aa
MAVSWIVFYLWLLTVFLGQIGGHSLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAAL
AMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVP
WPEDMECSRFPDCDEPYPRLVDLNLVGDPTEGAPVAVQRDYGFWCPRELKIDPDLGYSFL
HVRDCSPPCPNMYFRREELSFARYFIGLISIICLSATLFTFLTFLIDVTRFRYPERPIIF
YAVCYMMVSLIFFIGFLLEDRVACNASSPAQYKASTVTQGSHNKACTMLFMVLYFFTMAG
SVWWVILTITWFLAAVPKWGSEAIEKKALLFHASAWGIPGTLTIILLAMNKIEGDNISGV
CFVGLYDVDALRYFVLAPLCLYVVVGVSLLLAGIISLNRVRIEIPLEKENQDKLVKFMIR
IGVFSILYLVPLLVVIGCYFYEQAYRGIWETTWIQERCREYHIPCPYQVTQMSRPDLILF
LMKYLMALIVGIPSIFWVGSKKTCFEWASFFHGRRKKEIVNESRQVLQEPDFAQSLLRDP
NTPIIRKSRGTSTQGTSTHASSTQLAMVDDQRSKAGSVHSKVSSYHGSLHRSRDGRYTPC
SYRGMEERLPHGSMSRLTDHSRHSSSHRLNEQSRHSSIRDLSNNPMTHITHGTSMNRVIE
EDGTSA
NT seq 2001 nt   +upstreamnt  +downstreamnt
atggctgtgagctggattgtcttttatctttggctcttgactgtgtttctggggcagata
ggtgggcacagtttgttttcttgtgaacctataaccttgaggatgtgccaagatttgcct
tacaatactaccttcatgcctaatcttctgaaccattatgaccaacagactgcagcttta
gcaatggagcccttccaccctatggtgaacctggattgttctcgggattttcgaccattt
ctttgtgcactctatgcccctatttgtatggaatatggacgtgtcacacttccttgccgt
aggctgtgtcagcgtgcctatagcgagtgttcaaagctcatggagatgtttggtgtcccg
tggcctgaagatatggagtgcagtaggtttccagattgtgatgagccttatccccgactt
gtggatttgaatttagttggagatccaactgaaggagccccagttgcagtgcagagggat
tatggtttttggtgtccccgagagttgaaaattgatcctgatcttggctattcctttctg
cacgtgcgagattgttcaccaccatgtcccaatatgtacttcaggagagaagaactgtca
tttgctcgctatttcataggcctgatttcaatcatttgcctctctgccacattgtttact
tttttaacctttctaattgacgtcacaagattccgttaccctgaaagacctatcatattt
tatgcagtctgctacatgatggtgtcattaattttcttcattgggtttttgctggaggac
cgagtagcctgcaatgcatctagccctgcacagtataaggcttctacagtgacacaagga
tctcacaataaggcctgtaccatgctctttatggtactatattttttcactatggctggc
agtgtatggtgggtaattcttaccattacatggtttttagcagctgtgccaaagtggggc
agtgaagctattgagaagaaagcattgctgtttcatgccagtgcctggggcatccccgga
actctaactatcatccttttagcgatgaataaaattgaaggtgacaatattagtggcgtg
tgttttgtcggcctctacgacgttgatgcgttaagatatttcgttctcgctcccctctgc
ctatatgtggtagttggggtttctctccttttagccggcattatatccctaaacagagtt
cggattgagatcccattagaaaaggaaaaccaagataagttagtgaagttcatgatccgg
attggtgttttcagcattctctaccttgtgccactcctggttgtaattggatgttacttt
tatgagcaagcttaccgcggcatctgggagacaacatggatacaggaacgctgcagagag
tatcatattccatgtccgtaccaggttactcagatgagtcgtccagacctgatcctcttc
ctgatgaagtatctcatggctctcatagttgggattccctctattttttgggttggaagc
aaaaagacatgctttgaatgggccagttttttccatgggcgtaggaaaaaagagatagtg
aatgagagccgacaggtgctccaggaacctgactttgctcagtcacttctgagggaccca
aatactccaattataagaaaatcaagaggaacctccactcaagggacatccacacatgct
tcttcaactcagctggccatggtggatgaccaaagaagcaaagcagggagtgtccacagc
aaagtgagcagctaccatggcagcctccacaggtcacgggatggcaggtacactccctgc
agttaccgaggaatggaggagagactacctcatggcagcatgtcacggctgacggatcat
tccaggcacagtagttctcatcggctcaacgagcagtcccgacacagcagcatccgagac
ctcagtaacaaccccatgactcacattacacatggcaccagcatgaaccgagttattgag
gaggatggaaccagtgcttag

KEGG   Mus pahari (shrew mouse): 110325899
Entry
110325899         CDS       T05929                                 

Gene name
Fzd4
Definition
(RefSeq) frizzled-4
  KO
K02354  frizzled 4
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04150  mTOR signaling pathway
mpah04310  Wnt signaling pathway
mpah04390  Hippo signaling pathway
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04916  Melanogenesis
mpah04934  Cushing syndrome
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05165  Human papillomavirus infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05217  Basal cell carcinoma
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110325899 (Fzd4)
   04390 Hippo signaling pathway
    110325899 (Fzd4)
   04150 mTOR signaling pathway
    110325899 (Fzd4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110325899 (Fzd4)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110325899 (Fzd4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110325899 (Fzd4)
   05205 Proteoglycans in cancer
    110325899 (Fzd4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110325899 (Fzd4)
   05226 Gastric cancer
    110325899 (Fzd4)
   05217 Basal cell carcinoma
    110325899 (Fzd4)
   05224 Breast cancer
    110325899 (Fzd4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110325899 (Fzd4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110325899 (Fzd4)
   05022 Pathways of neurodegeneration - multiple diseases
    110325899 (Fzd4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110325899 (Fzd4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mpah04030]
    110325899 (Fzd4)
   04090 CD molecules [BR:mpah04090]
    110325899 (Fzd4)
G protein-coupled receptors [BR:mpah04030]
 Frizzled / Smoothened family
  110325899 (Fzd4)
CD molecules [BR:mpah04090]
 Proteins
  110325899 (Fzd4)
SSDB
Motif
Pfam: Frizzled Fz Chol_subst-bind
Other DBs
NCBI-GeneID: 110325899
NCBI-ProteinID: XP_021059724
Ensembl: MGP_PahariEiJ_G0013193
LinkDB
Position
1
AA seq 537 aa
MVWWGTGPSIRGAPGGVGLRLGLLLQLLLLLRPTLGFGDEEERRCDPIRIAMCQNLGYNV
TKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGM
CLSVKRRCEPVLKEFGFAWPDSLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEE
CHSVGSNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDIWMAVWASLCFISTTFTVLT
FLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAAEPVLIQEGLKNT
GCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTI
VILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNL
QKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYEISNWALFRYSADDSNMAVEMLK
IFMSLLVGITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGNETVV
NT seq 1614 nt   +upstreamnt  +downstreamnt
atggtctggtggggcacagggccgagcatccggggggcgcctggaggcgtcggactcagg
ctggggctgctgctgcagttgctcctgctcctgcggccgacactggggttcggggacgag
gaggagcggcgctgcgaccccatccgcatcgccatgtgccagaacctcggctacaacgtg
accaagatgcccaacttagtgggacacgagctgcagacagatgcggagctgcagctgaca
actttcacgccgctcatccagtacggctgctccagccagctgcagttcttcctttgttcg
gtttatgtgccaatgtgcacagagaagatcaacatccccatcggcccgtgcggtggcatg
tgtctttcagtcaagagacgctgtgaaccagtcctgaaagaattcgggtttgcctggccg
gacagcctgaactgcagcaagttcccaccccagaatgaccacaaccacatgtgcatggaa
ggaccaggtgatgaagaggtacccttgccccacaaaactcccatccagcccggggaagag
tgccactcagtgggaagcaattctgatcagtacatctgggtgaagaggagcctgaactgt
gttctcaagtgtggctacgatgctggcttatacagccgctcagctaaagagttcacggat
atttggatggctgtgtgggccagcctctgcttcatctctactaccttcactgtgctgacc
ttcctgatcgattcatccaggttttcttaccctgagcgccccatcatatttctcagtatg
tgctataatatttatagcattgcttatattgttcggctgactgtaggccgggaaaggata
tcctgtgattttgaagaggcggcagaacccgttctcatccaagaaggacttaagaacaca
ggatgtgcaataattttcttgctgatgtacttttttggaatggccagctccatttggtgg
gttattctgacactcacttggtttttggcagccggactcaagtggggtcatgaagccatt
gaaatgcacagttcttatttccacatcgcagcctgggctattcccgcagtgaaaaccatt
gtcatcttgattatgagactagtggatgccgatgaattgactggcttgtgctatgttggg
aaccaaaacctagatgccctcactggctttgtggtggctcctctctttacgtatttggtg
attggaacgctgttcattgcagcgggtttggtggccttattcaaaattcggtccaatctt
caaaaagatgggacaaaaacagacaagttggaaaggctaatggtcaagattggggtcttc
tcagtactgtacacggttcctgcaacctgtgtgattgcctgttatttctatgaaatctca
aactgggcactcttccgatattctgccgatgactcaaacatggcagtcgaaatgttgaaa
atttttatgtctttgctcgtgggcatcacttcaggcatgtggatttggtctgccaaaact
cttcacacgtggcaaaagtgttctaaccgactggtgaattctgggaaggtaaagagagag
aagagggggaatggttgggtgaagccagggaaaggaaatgagactgtggtataa

KEGG   Mus pahari (shrew mouse): 110331922
Entry
110331922         CDS       T05929                                 

Gene name
Fzd2
Definition
(RefSeq) frizzled-2
  KO
K02235  frizzled 2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04150  mTOR signaling pathway
mpah04310  Wnt signaling pathway
mpah04390  Hippo signaling pathway
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04916  Melanogenesis
mpah04934  Cushing syndrome
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05165  Human papillomavirus infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05217  Basal cell carcinoma
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110331922 (Fzd2)
   04390 Hippo signaling pathway
    110331922 (Fzd2)
   04150 mTOR signaling pathway
    110331922 (Fzd2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110331922 (Fzd2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110331922 (Fzd2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110331922 (Fzd2)
   05205 Proteoglycans in cancer
    110331922 (Fzd2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110331922 (Fzd2)
   05226 Gastric cancer
    110331922 (Fzd2)
   05217 Basal cell carcinoma
    110331922 (Fzd2)
   05224 Breast cancer
    110331922 (Fzd2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110331922 (Fzd2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110331922 (Fzd2)
   05022 Pathways of neurodegeneration - multiple diseases
    110331922 (Fzd2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110331922 (Fzd2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mpah04030]
    110331922 (Fzd2)
G protein-coupled receptors [BR:mpah04030]
 Frizzled / Smoothened family
  110331922 (Fzd2)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 110331922
NCBI-ProteinID: XP_021068452
Ensembl: MGP_PahariEiJ_G0018387
LinkDB
Position
14
AA seq 570 aa
MRARSALPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDIAYNQT
IMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICE
RARQGCEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGAPALLTTAPPFGLQPG
AGGTPGGPGGGGAPPRYATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMF
FSQEETRFARLWILTWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYI
AGFVLQERVVCNERFSEDGYRTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLA
AGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGF
VLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLERLMVRIGVFSVLYTVPATI
VIACYFYEQAFREHWERSWVSQHCKSLAIPCPAHYTPRMSPDFTVYMIKYLMTLIVGITS
GFWIWSGKTLHSWRKFYTRLTNSRHGETTV
NT seq 1713 nt   +upstreamnt  +downstreamnt
atgcgggcccgcagcgccctgccccgcagcgccctgccccgcctgctgctgccactgctg
ctgctgccggccgctggaccggcccagttccacggggagaagggcatctccatcccggac
cacggcttctgccagcccatctccatcccgctgtgcacggacatcgcctacaaccagacc
atcatgcccaaccttcttggccacacgaaccaggaggacgcgggcctggaggtgcatcag
ttctacccgctggtgaaggtgcagtgctcgccggagctgcgcttctttctgtgctccatg
tacgctccggtgtgcacagtgctggagcaggccatcccgccgtgccgctccatctgcgag
cgcgcgcgccaaggctgcgaggcgctcatgaacaagttcggcttccagtggcccgagcgc
ctccgctgcgagcatttcccgcgtcacggcgcggagcagatctgcgtgggccagaaccac
tcggaggacggagctcctgcgctactcaccaccgcgccaccttttgggctgcagcccggc
gcgggtggcaccccgggcggccctggcggtggtggcgcgcccccgcgctacgccactctg
gagcaccctttccactgtccccgcgtcctcaaggtgccgtcctatctcagctataagttt
ctgggtgagcgcgattgtgccgcgccctgcgagcctgcacggcccgacggctctatgttc
ttctcgcaagaggagactcgttttgcccgtctctggatcctcacatggtcagtgctgtgc
tgcgcttccaccttcttcacggtcaccacctatttagtggacatgcagcgattccgctac
ccagagcggcccatcatctttctgtccggctgctacaccatggtatcagtggcctacatt
gcgggcttcgtactccaggagcgcgtggtgtgcaacgagcgcttctctgaggacggttat
cgcacggtggtgcagggcactaagaaagaaggctgcactatactcttcatgatgctctac
ttcttcagcatggccagctccatctggtgggtgattctgtccctcacctggttcctggca
gccggtatgaagtggggccacgaggccatcgaggccaattcgcagtacttccacctggcc
gcctgggccgtgccggccgtcaaaaccatcaccatcctggccatgggccagatcgacggc
gacctgctgagcggcgtgtgcttcgtgggcctcaacagcctggacccgctgcggggcttc
gtactggcgccgctcttcgtatacctgttcatcggtacatccttcctgctggccggcttc
gtgtcactcttccgcatccgcaccatcatgaagcacgacggcaccaagacggagaagctg
gagaggctcatggtgcgcatcggcgtcttctcggtgctctacacggtaccggccaccata
gtcatcgcctgctacttctatgagcaggccttccgcgagcactgggagcgctcctgggta
agccagcactgcaagagcctagccatcccctgcccggcccactacacgccccgcatgtcg
cccgacttcacagtctacatgatcaaatacctcatgacgctcatcgtgggcatcacgtcg
ggcttctggatctggtccggcaagacactgcactcgtggaggaagttctacacgcgtctc
accaacagtcggcatggcgagaccaccgtgtga

KEGG   Mus pahari (shrew mouse): 110333155
Entry
110333155         CDS       T05929                                 

Gene name
Fzd8
Definition
(RefSeq) frizzled-8
  KO
K02375  frizzled 5/8
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04150  mTOR signaling pathway
mpah04310  Wnt signaling pathway
mpah04390  Hippo signaling pathway
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04916  Melanogenesis
mpah04934  Cushing syndrome
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05165  Human papillomavirus infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05217  Basal cell carcinoma
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110333155 (Fzd8)
   04390 Hippo signaling pathway
    110333155 (Fzd8)
   04150 mTOR signaling pathway
    110333155 (Fzd8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110333155 (Fzd8)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110333155 (Fzd8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110333155 (Fzd8)
   05205 Proteoglycans in cancer
    110333155 (Fzd8)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110333155 (Fzd8)
   05226 Gastric cancer
    110333155 (Fzd8)
   05217 Basal cell carcinoma
    110333155 (Fzd8)
   05224 Breast cancer
    110333155 (Fzd8)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110333155 (Fzd8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110333155 (Fzd8)
   05022 Pathways of neurodegeneration - multiple diseases
    110333155 (Fzd8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110333155 (Fzd8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mpah04030]
    110333155 (Fzd8)
G protein-coupled receptors [BR:mpah04030]
 Frizzled / Smoothened family
  110333155 (Fzd8)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 110333155
NCBI-ProteinID: XP_021070284
Ensembl: MGP_PahariEiJ_G0018721
LinkDB
Position
15
AA seq 685 aa
MEWGYLLEVTSLLAALAVLQRSSGAAAASAKELACQEITVPLCKGIGYNYTYMPNQFNHD
TQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAP
LMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAPSPPRRLPPPPPPGEQPPSG
SGHSRPPGARPPHRGGSSRGSGDSVAAPPSRGGKARPPGGGAAPCEPGCQCRAPMVSVSS
ERHPLYNRVKTGQIANCALPCHNPFFSQDERAFTVFWIGLWSVLCFVSTFATVSTFLIDM
ERFKYPERPIIFLSACYLFVSVGYLVRLVAGHEKVACSGGAPGAGGAGGAGGAAAAGAGA
AGAGASSPGARGEYEELGAVEQHVRYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWF
LAAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQSLDNLR
GFVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIKQQGGPTKTHKLEKLMIRLGLFTVLYTV
PAAVVVACLFYEQHNRPRWEATHNCPCLRDLQPDQARRPDYAVFMLKYFMCLVVGITSGV
WVWSGKTLESWRALCTRCCWASKGAAVGAGAGGSGLGGSGPGPGGGGGHGGGGGSLYSDV
STGLTWRSGTASSVSYPKQMPLSQV
NT seq 2058 nt   +upstreamnt  +downstreamnt
atggagtggggttacctgttggaagtgacctcgctgctagccgccttggcggtgctacag
cgctctagcggcgctgcggcggcttcggccaaggagctggcgtgccaagagatcacagtg
ccgttgtgcaaaggcatcggttacaactacacgtacatgcccaaccagttcaaccacgac
acgcaggatgaggcgggcctagaggtgcaccagttttggccgctggtggagatacagtgc
tccccggacctcaagttctttctgtgtagcatgtacacgcccatctgcctggaggactac
aagaagcctctgccgccttgtcgctctgtgtgtgaacgcgccaaggccggctgcgcgccg
ctcatgcgccagtacggctttgcctggcctgaccgcatgcgctgcgatcggttgccggag
cagggcaacccggacactctgtgcatggactacaaccgcaccgacctcaccacggccgcg
cccagcccaccgcgccgcctgcctccgccgcctccgcccggcgagcagccgccctctggc
agcggccacagccgcccgccgggggccaggcccccacatcgtggcggcagcagtaggggc
agcggggactcggtggctgcgcccccttcgcgcggcgggaaggcgaggccccctggtggc
ggcgctgctccctgcgagccggggtgccagtgccgcgcgcccatggtgagcgtgtccagc
gaacgccacccgctctacaaccgcgtcaagaccggccagatcgccaactgtgcgctgccc
tgccataaccccttctttagccaggatgagcgcgccttcaccgtcttctggatcggcctg
tggtcggtgctctgcttcgtctccaccttcgccaccgtctctaccttcctcatcgatatg
gagcgctttaagtacccggaacggcccatcatattcctctccgcctgttacctcttcgtg
tctgtcgggtacctggtgcgcctggtggcaggacacgagaaagtggcctgcagcggcggc
gctccgggtgcgggcggagctgggggtgcgggcggcgcggcggcggctggcgctggggcg
gcgggagcgggggcgagcagcccgggcgcgcgcggcgagtacgaggagcttggcgcagtc
gagcagcatgtgcgctatgagaccactggccccgcgctgtgcacggtggtctttctcctt
gtctacttttttggcatggccagctccatctggtgggtaatcctgtcgctcacgtggttc
ttggcggctggcatgaagtggggtaacgaggccatagcaggctactcgcagtacttccac
ctggccgcgtggctcgtgcccagcgtcaagtccatcgcggtgctggcgctcagctccgta
gacggcgacccggtggcgggcatctgctacgtgggcaaccagagccttgacaacctacgc
ggctttgtgctggctccactggtcatctacctcttcattgggactatgtttctgttagct
ggcttcgtgtcgctgttccgaatccgctcagtcatcaagcagcaaggaggcccaactaag
acacacaagctagaaaaactcatgatccgcttgggcctcttcaccgtgctctacacggtg
cccgctgccgtcgttgtcgcctgccttttctatgagcagcacaaccgaccgcgctgggag
gccacgcacaactgcccgtgccttcgggacctgcaaccggaccaggctcgcaggcccgat
tacgcggtcttcatgctcaagtacttcatgtgcctagtggtgggcatcacatcgggtgtg
tgggtctggtccggcaagactctggagtcctggcgcgcgttgtgcactcggtgctgctgg
gccagcaagggcgctgcagtaggcgcgggcgcaggaggcagtggccttgggggcagtggc
cccgggcccggcgggggtgggggacacggcggaggcgggggatccctctacagcgacgtc
agcaccggcctgacgtggcggtctggcacggccagctctgtatcttaccctaagcaaatg
ccattgtcccaggtctga

KEGG   Mus pahari (shrew mouse): 110334890
Entry
110334890         CDS       T05929                                 

Gene name
Fzd6
Definition
(RefSeq) frizzled-6
  KO
K02376  frizzled 6
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04150  mTOR signaling pathway
mpah04310  Wnt signaling pathway
mpah04390  Hippo signaling pathway
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04916  Melanogenesis
mpah04934  Cushing syndrome
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05165  Human papillomavirus infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05217  Basal cell carcinoma
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110334890 (Fzd6)
   04390 Hippo signaling pathway
    110334890 (Fzd6)
   04150 mTOR signaling pathway
    110334890 (Fzd6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110334890 (Fzd6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110334890 (Fzd6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110334890 (Fzd6)
   05205 Proteoglycans in cancer
    110334890 (Fzd6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110334890 (Fzd6)
   05226 Gastric cancer
    110334890 (Fzd6)
   05217 Basal cell carcinoma
    110334890 (Fzd6)
   05224 Breast cancer
    110334890 (Fzd6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110334890 (Fzd6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110334890 (Fzd6)
   05022 Pathways of neurodegeneration - multiple diseases
    110334890 (Fzd6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110334890 (Fzd6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mpah04030]
    110334890 (Fzd6)
G protein-coupled receptors [BR:mpah04030]
 Frizzled / Smoothened family
  110334890 (Fzd6)
SSDB
Motif
Pfam: Frizzled Fz Folate_rec Integrin_alpha RseC_MucC
Other DBs
NCBI-GeneID: 110334890
NCBI-ProteinID: XP_021072555
Ensembl: MGP_PahariEiJ_G0019763
LinkDB
Position
17
AA seq 709 aa
MERSPFLLACILLPLVRGHSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQGIAAVEMEH
FLPLANLECSPNIEMFLCQAFVPTCTEQIHVVPPCRKLCEKIVSDCKKLMDTFDIRWPEE
LECNRLPYCDDTVPVTSHPHTELFGPQKKTDQVPRDIGFWCPKHLRTPGDQGYRFLGIEQ
CAPPCPNMYFKSDELDFAKSFIGIVSIFCLCATLFTFLTFLIDVRRFRYPERPIIYYSVC
YSIVSLMYFVGFLLGNSTACNKADEKLELGDTVVLGSKNKACSVVFMFLYFFTMAGTVWW
VILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGAPGFLTVMLLAMNKVEGDNISGVCFVG
LYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVF
SGLYLVPLVTLLGCYVYELVNRITWEMTWFSDHCHQYRIPCPYQANPKARPELALFMIKY
LMTLIVGISAVFWVGSKKTCTEWAGFFKRNRKRDPISESRRVLQESCEFFLKHNSKVKHK
KKHCKPGAHKLKVISKSMGTSTGATTNHGTSAIAIADHDYLGQGTSTEVQTSPEASVKEG
RADRANTPSAKDRDCGDPAGPSSRLSGDRNDRESRAGGVKERSNGSEGAPSEGRVSPKSS
VPETGLTDCSTSQAASSPEPTSLKGSTSLPVHSASRARKEQGTGSHSDA
NT seq 2130 nt   +upstreamnt  +downstreamnt
atggaaaggtccccgtttctgctggcgtgcatacttctgcccctcgtaagaggtcacagc
cttttcacctgtgagccaatcaccgttcccagatgtatgaaaatggcgtacaacatgacg
ttcttccctaacctgatgggtcattatgaccaggggatcgctgctgtggaaatggagcac
tttctgcctcttgcaaatctagaatgttcaccaaacattgaaatgttcctttgccaagct
ttcgtaccaacctgcacagagcaaattcatgtagttccaccctgtcggaaattgtgtgag
aaaatagtttctgattgcaaaaaactaatggacacttttgacatccgatggcctgaagaa
cttgaatgtaacagattgccatactgtgatgacactgttcctgtaacttctcatccacac
acagagctttttggtccacagaagaaaacagatcaagtcccaagagacattggattttgg
tgtccaaagcaccttaggactcctggggaccaaggctacaggtttctgggaattgaacag
tgtgcccctccgtgccccaacatgtattttaaaagtgatgaactagactttgccaaaagt
ttcataggaatagtttcaatattttgtctttgtgcaactctgttcaccttccttacattt
ttaattgatgttagaagattcagatacccagagagaccgattatctattactctgtctgt
tacagcattgtctctctcatgtacttcgtggggtttttgctgggcaatagcacggcttgt
aataaggcagacgagaagctggagcttggggacaccgttgtcctggggtcaaagaataag
gcttgcagtgtggtatttatgtttctgtattttttcacgatggctggcaccgtgtggtgg
gtgattctcaccattacgtggttcttagctgccgggagaaaatggagttgcgaggctatt
gaacaaaaggcagtgtggttccatgctgttgcctggggggcaccggggttcctgaccgtc
atgctgctcgctatgaacaaggttgaaggagacaacattagcggcgtttgcttcgttggc
ctctatgacctggacgcctcgcgctacttcgtccttctgcctctgtgcctctgcgtattt
gttgggctgtctctcctcttagccggcatcatctccttaaatcatgttcggcaagtcata
cagcatgatggccggaaccaagagaagctaaagaaattcatgattcgcattggagtcttc
agtggcctgtatcttgtgcccttagtgacccttcttggttgctatgtctatgagctagtg
aacagaatcacctgggagatgacgtggttctctgatcattgtcaccagtaccgcatcccg
tgtccttatcaggcaaatccaaaagctcgaccagaattggctttatttatgataaaatat
ctgatgacattaattgttggtatctctgcggtcttctgggttggaagcaaaaagacgtgc
acagaatgggccgggttctttaagcgaaaccgcaagcgagaccccatcagtgagagccga
cgagtgctgcaagagtcctgtgagttcttcctgaagcacaactctaaagtgaagcacaag
aagaaacattgcaaaccaggggctcataagctgaaggtcatttccaagtccatgggaact
agcaccggagcgaccacaaatcatggcacctctgccatagcaatcgctgaccatgattac
ttagggcaaggaacgtcaacagaagtccagacctccccagaggcatccgtgaaagaggga
cgggcagaccgagcgaacactcccagtgccaaagatcgggactgtggggatcctgcaggg
cccagctccagactctctggggacaggaacgacagggaaagccgagcaggtggtgtgaag
gagagaagcaatggatcagaaggggctccaagtgagggaagggtaagtccaaagagcagc
gttccggagactggcctgacagactgcagcacttcacaggccgccagttctccagaacca
accagcctcaaaggttccacatctctgcctgttcactcagcttccagagccaggaaagag
cagggtactggcagccattccgacgcttga

KEGG   Mus pahari (shrew mouse): 110339184
Entry
110339184         CDS       T05929                                 

Gene name
Fzd10
Definition
(RefSeq) frizzled-10
  KO
K02842  frizzled 9/10
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04150  mTOR signaling pathway
mpah04310  Wnt signaling pathway
mpah04390  Hippo signaling pathway
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04916  Melanogenesis
mpah04934  Cushing syndrome
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05165  Human papillomavirus infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05217  Basal cell carcinoma
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110339184 (Fzd10)
   04390 Hippo signaling pathway
    110339184 (Fzd10)
   04150 mTOR signaling pathway
    110339184 (Fzd10)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110339184 (Fzd10)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110339184 (Fzd10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110339184 (Fzd10)
   05205 Proteoglycans in cancer
    110339184 (Fzd10)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110339184 (Fzd10)
   05226 Gastric cancer
    110339184 (Fzd10)
   05217 Basal cell carcinoma
    110339184 (Fzd10)
   05224 Breast cancer
    110339184 (Fzd10)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110339184 (Fzd10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110339184 (Fzd10)
   05022 Pathways of neurodegeneration - multiple diseases
    110339184 (Fzd10)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110339184 (Fzd10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mpah04030]
    110339184 (Fzd10)
   04090 CD molecules [BR:mpah04090]
    110339184 (Fzd10)
G protein-coupled receptors [BR:mpah04030]
 Frizzled / Smoothened family
  110339184 (Fzd10)
CD molecules [BR:mpah04090]
 Proteins
  110339184 (Fzd10)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 110339184
NCBI-ProteinID: XP_021078388
Ensembl: MGP_PahariEiJ_G0024354
LinkDB
Position
23
AA seq 582 aa
MRHPGPRLWLVLQVMIGSCAAISSMDLERPGDGKCQPVEIPMCKDIGYNTTRMPNLMGHE
NQREAAIQLHEFAPLVEYGCHSHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSP
IMEQFKFRWPDSLDCSKLPNKNDPNYLCMEAPNNGSDEPSRGSGMFPPLFRPQRPHSAQE
HPLKDGGPGRAGCDNPGKFHHVEKSESCAPLCTPGVDVYWSRDDKRFAVVWLAIWSVLCF
FSSAFTVLTFLIDPSRFRYPERPIIFLSMCYCVYSVGYIIRLFAGAESIACDRDSGQLYV
IQEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAW
AIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLVPLACYLVIGTSFILSGFVA
LFHIRRVMKTGGENTDKLEKLMVRIGVFSLLYTVPATCVIACYFYERLNMDYWKMLATQH
KCKMNNQTKTPDCLMTTSIPAVEVFMVKVSMLLVVGITSGVWVWTSKTLQSWQHVCSRGL
KRKSRRKPASVVTSAGIYKKAQHPQKPHLGKYELPAQPSACV
NT seq 1749 nt   +upstreamnt  +downstreamnt
atgcgacacccgggcccgcgcctgtggctggtgctgcaggtgatgataggctcgtgcgcg
gccatcagctccatggacttagagcgccctggagacggcaagtgccagccggtggagatt
cccatgtgcaaggacatcggctacaacaccacccgcatgcccaacctgatgggtcacgag
aaccagcgcgaggcggccatccaactgcacgagttcgcgccgctcgtggagtacggctgc
cacagccacctccgcttcttcctgtgttcgctgtacgcgcccatgtgtacggagcaggtc
tccacacccatccctgcttgccgggtcatgtgcgagcaggcccggctcaagtgctcgccg
atcatggagcagttcaaattcaggtggccggactccctggattgcagcaagctccccaac
aagaacgaccccaactacctgtgcatggaggcacccaacaacggctcggatgagcccagt
cgtggctctggcatgtttcctccgctcttcaggccccagaggccccacagcgcgcaggag
cacccactaaaggacgggggtccggggcgcgcaggttgtgacaatccaggcaagttccac
cacgtggagaagagcgaatcctgcgcaccgctttgcactccgggggtggatgtgtactgg
agccgcgacgacaagcgcttcgctgtggtctggctggccatctggtccgtgctgtgcttt
ttctccagcgccttcaccgtactcaccttcctcatcgacccctcgcgcttcaggtacccc
gaacgtcctatcatcttcctctccatgtgctactgcgtttattcggtgggctatatcatc
cgcctcttcgcgggcgcggagagcatcgcctgtgaccgggacagtgggcagctgtatgtt
atccaggaagggctggagagcacgggctgtaccttagtcttcttggtactttactacttc
ggcatggccagctctttatggtgggtggttctcaccctcacttggttcctggctgctggc
aagaagtggggccatgaggccattgaagccaacagcagctactttcacctggcagcctgg
gccatcccggctgtgaagactatcttgatcttggtgatgcgcagggtggcaggggatgag
ctcactggtgtgtgttatgtgggcagcatggatgtcaatgctctgaccggcttcgtgctg
gtccctctggcttgctacctagtcatcggcacttccttcatcctgtccgggtttgtggct
ttattccacatccggagggtgatgaaaacgggtggggagaacacggacaagctggagaag
ctcatggtacgcattggggtcttctccctcctctacactgtgccggccacctgtgtgatt
gcctgctatttttatgaacgcctcaacatggactactggaagatgctggccacccagcac
aagtgtaagatgaacaatcagaccaagacacccgactgcctgatgaccacctccatccct
gccgtggaggtcttcatggtcaaagtgtccatgctgctggtggtgggcatcaccagtggg
gtgtgggtctggacttccaagaccttgcagtcctggcaacatgtatgcagccgggggcta
aagagaaaaagccggaggaaaccagccagtgtggtcaccagtgcagggatctacaaaaaa
gcccagcacccccaaaaacctcacctcgggaagtatgaacttccggcccagccttcagcc
tgcgtgtga

DBGET integrated database retrieval system