KEGG   Mus pahari (shrew mouse): 110312979Help
Entry
110312979         CDS       T05929                                 

Gene name
Ncf1
Definition
(RefSeq) neutrophil cytosol factor 1 isoform X1
  KO
K08011  neutrophil cytosolic factor 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04062  Chemokine signaling pathway
mpah04145  Phagosome
mpah04380  Osteoclast differentiation
mpah04666  Fc gamma R-mediated phagocytosis
mpah04670  Leukocyte transendothelial migration
mpah05140  Leishmaniasis
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110312979 (Ncf1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    110312979 (Ncf1)
   04670 Leukocyte transendothelial migration
    110312979 (Ncf1)
   04062 Chemokine signaling pathway
    110312979 (Ncf1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110312979 (Ncf1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110312979 (Ncf1)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    110312979 (Ncf1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110312979 (Ncf1)
Membrane trafficking [BR:mpah04131]
 Endocytosis
  Phagocytosis
   NADPH oxidase complex
    110312979 (Ncf1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    110312979 (Ncf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH3_1 NECFESHC SH3_9 p47_phox_C PX SH3_2 hSH3 SH3_3
Motif
Other DBs
NCBI-GeneID: 110312979
NCBI-ProteinID: XP_021042632
Ensembl: MGP_PahariEiJ_G0024375
LinkDB All DBs
Position
23
AA seq 404 aa AA seqDB search
MGDTFIRHIALLGFEKRFVPSQHYVYMFLVKWQDLSEKVVYRKFTEIYEFHKMLKEMFPI
EAGEIHTENRIIPHLPAPRWFDGQRAAESRQGTLTEYFNSLMGLPVKISRCPHLLDFFKV
RPDDLKLPTDSQVKKPETYLMPKDGKNNVADITGPIILQTYRAIADYEKSSGTEMTVATG
DVVDVVEKSESGWWFCQMKTKRGWVPASYLEPLDSPDEAEDPDPNYEGEPYVTIKAYAAV
EEDEVSLSEGEAIEVIHKLLDGWWVVRKGDITGYFPSMYLQKAGEEITQAQRQIRGRGAP
PRRSTIRNAQSIHQRSRKRLSQDTYRRNSVRFLQQRRRPARPGPQSKDGAKGERQGGAGP
GLAGGDNPSTPRVKPQPAVPPRPSSDLILHRCTESTKRKLTSAV
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgggggacaccttcattcgccatatcgccctcctgggcttcgagaagcgctttgtcccc
agccaacactatgtgtacatgttcctggttaagtggcaggacctgtcggagaaggtggtc
tacaggaaattcaccgagatctacgagttccataaaatgctaaaggagatgttccccatt
gaggccggtgagatccacacagagaacagaatcatcccgcacctcccggcacccaggtgg
tttgatgggcagcgagccgctgagagccgtcagggcacgctcaccgagtacttcaacagc
ctcatgggtctgcccgtgaagatctcccgctgcccacacctgctggacttcttcaaagtg
cgccccgatgacttgaaactgcccacggacagccaggtgaagaagccagagacatacctg
atgcccaaagatggcaagaataacgtagctgacatcacaggccccatcatccttcagacc
tatcgggccatcgctgactacgagaagagttcaggaacggagatgactgtggcaacggga
gatgtggtggatgtcgtggagaaaagcgagagtggatggtggttttgccagatgaagaca
aagcgaggttgggtccctgcatcctatctggagccccttgacagtcccgacgaggcggag
gatccggatcccaactacgaaggtgaaccgtatgtaaccatcaaagcgtacgctgctgta
gaagaggacgaggtgtccctgtctgagggtgaagccatcgaggtcattcataagctcctg
gatggctggtgggtggtcaggaaaggggatatcaccggctacttcccatccatgtatctg
cagaaggctggggaggagataacccaggcccagcgacagatcagaggccgcggggcacca
cctcgaaggtcgaccatccgcaacgcacagagcatccaccagcgttctcggaagcgcctc
agccaggacacctatcgccgcaacagcgtccgattcctgcagcagcgcagacgcccggcg
cgacccgggccgcagagcaaggatggcgcaaagggtgagcgccagggcggggcggggccg
gggctggcgggcggggacaatccatcgactccgcgggtcaaaccacaacccgcggtgcct
ccgcgacccagctcggacctcatcctgcaccgctgcacggagagcaccaagcggaagctg
acgtccgctgtgtga

DBGET integrated database retrieval system