KEGG   Mus pahari (shrew mouse): 110313054Help
Entry
110313054         CDS       T05929                                 

Gene name
Aldh2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial isoform X1
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00010  Glycolysis / Gluconeogenesis
mpah00053  Ascorbate and aldarate metabolism
mpah00071  Fatty acid degradation
mpah00280  Valine, leucine and isoleucine degradation
mpah00310  Lysine degradation
mpah00330  Arginine and proline metabolism
mpah00340  Histidine metabolism
mpah00380  Tryptophan metabolism
mpah00410  beta-Alanine metabolism
mpah00561  Glycerolipid metabolism
mpah00620  Pyruvate metabolism
mpah01100  Metabolic pathways
Module
mpah_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110313054 (Aldh2)
   00053 Ascorbate and aldarate metabolism
    110313054 (Aldh2)
   00620 Pyruvate metabolism
    110313054 (Aldh2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110313054 (Aldh2)
   00561 Glycerolipid metabolism
    110313054 (Aldh2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    110313054 (Aldh2)
   00310 Lysine degradation
    110313054 (Aldh2)
   00330 Arginine and proline metabolism
    110313054 (Aldh2)
   00340 Histidine metabolism
    110313054 (Aldh2)
   00380 Tryptophan metabolism
    110313054 (Aldh2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110313054 (Aldh2)
Enzymes [BR:mpah01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     110313054 (Aldh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1235
Motif
Other DBs
NCBI-GeneID: 110313054
NCBI-ProteinID: XP_021042739
Ensembl: MGP_PahariEiJ_G0024268
LinkDB All DBs
Position
23
AA seq 519 aa AA seqDB search
MLRAALTTARRAPRLSRLLSAAATSAVPAPNHQPEVFCNQIFINNEWHDAVSRKTFPTVN
PSTGEVICQVAEGNKEDVDKAVKAARAAFQLGSPWRRMDASDRGRLLYRLADLIERDRTY
LAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGV
CGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIV
PGFGPTAGAAIASHEDVDKVAFTGSTEVGHLIQVAAGSSNLKRVTLELGGKSPNIIMSDA
DMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYDEFVERSVARAKSRVVGNPFDSRTEQ
GPQVDETQFKKILGYIKSGQQEGAKLLCGGGAAADRGYFIQPTVFGDVKDSMTIAKEEIF
GPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWINCYDVFGA
QSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgtgccgcactcaccaccgcccgccgcgcaccgcgcctgagccgcctgctgtcc
gccgccgccaccagcgcggtgccagcccccaaccatcagcccgaggtcttctgcaaccag
atcttcattaacaatgagtggcacgacgccgtcagcaggaaaacatttcccactgtcaac
ccttccacaggggaggtcatctgccaggtagccgaagggaacaaggaggatgtagacaag
gcggtgaaggccgctcgcgcagccttccagctgggctcgccctggcgccgcatggatgca
tctgaccggggccggctgctgtaccgattggcggatctcatcgagcgggaccggacctac
ctggcggctttggagaccctggacaatggcaagccttatgtcatctcttacctggtggat
ttggacatggtcctgaagtgtctccgctattacgctggctgggctgacaagtaccatggg
aaaaccattcccattgacggcgacttcttcagctacacccgccatgagcccgtgggtgtg
tgtggacagatcattccgtggaacttcccgctcctgatgcaagcatggaaactgggccca
gccttggcaaccgggaacgtggtggtcatgaaggtggccgagcagacaccgctcacggcg
ctctatgtggccaacttgatcaaggaggcaggcttcccccctggcgtggtcaatatcgtt
cctggattcggccctacggctggggccgccattgcatctcatgaggatgtggacaaagtg
gcgttcacaggctccactgaggttggtcacctgatccaggtggccgccgggagcagcaac
ctcaagagagtaaccctggagctgggggggaagagccccaacatcatcatgtccgacgct
gacatggactgggctgtggagcaggcccactttgccctgttcttcaaccagggccagtgc
tgctgcgcaggctcccggaccttcgtgcaggaggatgtgtatgacgaatttgtggaacgc
agtgtggcccgggccaagtctcgggtggtggggaaccccttcgacagccggacggagcag
gggcctcaggtggatgagactcagtttaagaagatcctaggctatatcaaatcgggacag
caagaaggagcgaagctgctgtgtggtgggggtgccgccgcggaccgtggctacttcatc
cagcccaccgtgttcggggacgtaaaagacagcatgaccattgccaaggaggagatcttc
ggaccagtgatgcaaatcctcaaattcaagaccatcgaggaggttgtggggcgagccaat
aattcgaagtacgggctggcagccgccgtcttcacaaaggacctggataaagccaattac
ctgtctcaggctctgcaggctggcactgtgtggatcaactgctacgatgtgtttggggcc
cagtctccatttggtggctataagatgtcagggagtggcagggagctgggcgagtatggc
ctgcaggcctacacggaagtgaagacggtcaccgtcaaagtgccacagaagaactcgtaa

DBGET integrated database retrieval system