KEGG   Mus pahari (shrew mouse): 110313227
Entry
110313227         CDS       T05929                                 

Gene name
Epo
Definition
(RefSeq) erythropoietin isoform X1
  KO
K05437  erythropoietin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04066  HIF-1 signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04640  Hematopoietic cell lineage
mpah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110313227 (Epo)
   04066 HIF-1 signaling pathway
    110313227 (Epo)
   04151 PI3K-Akt signaling pathway
    110313227 (Epo)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110313227 (Epo)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110313227 (Epo)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110313227 (Epo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110313227 (Epo)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  CSF and other factors
   110313227 (Epo)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 110313227
NCBI-ProteinID: XP_021042908
Ensembl: MGP_PahariEiJ_G0024461
LinkDB
Position
23
AA seq 193 aa
MGVPERPTLLFLLSLLLIALGLPVLCAPPRLICDSPVLERYILEAKEAENVTTMGCAEGP
RLSENITVPDTKVNFYAWKRMEVEEQAVDVWQGLSLLSEAILQARALLANSSQPPETLQL
HIDKAISGLRSLTSLLRVLGAQKELMSPPDTTPPAPLRTLTVDTFCKLFRVYANFLRGKL
KLYTGEVCRRGDR
NT seq 582 nt   +upstreamnt  +downstreamnt
atgggggtgcccgaacgtcccaccctgctgtttttactttccttgctactgattgctctg
ggcctcccagtcctctgtgctcccccacgcctcatctgcgacagtccagtcctggagagg
tacatcctggaggccaaggaggcagaaaatgtcaccacgatgggttgtgcggaaggtccc
cgactgagcgaaaatattacagtcccggacaccaaagtcaacttctatgcttggaaaaga
atggaggtggaagaacaggccgtagacgtttggcaaggcctgtccctgctctcagaagcc
atcctgcaggcccgggctctgctagccaattcctcccagccaccagagacccttcagctt
catatagacaaagccatcagtggtctacgtagcctcacgtcactgcttcgggtgctggga
gctcagaaggaactgatgtcgcctccagataccaccccacctgctccactccgaacactc
acagtggatactttctgcaagctcttccgggtctatgccaacttcctccgggggaaactg
aagctgtacacgggagaggtctgcaggaggggggacaggtga

DBGET integrated database retrieval system