KEGG   Mus pahari (shrew mouse): 110313227
Entry
110313227         CDS       T05929                                 

Gene name
Epo
Definition
(RefSeq) erythropoietin isoform X1
  KO
K05437  erythropoietin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04066  HIF-1 signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04640  Hematopoietic cell lineage
mpah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110313227 (Epo)
   04066 HIF-1 signaling pathway
    110313227 (Epo)
   04151 PI3K-Akt signaling pathway
    110313227 (Epo)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110313227 (Epo)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110313227 (Epo)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110313227 (Epo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110313227 (Epo)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  CSF and other factors
   110313227 (Epo)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 110313227
NCBI-ProteinID: XP_021042908
Ensembl: MGP_PahariEiJ_G0024461
LinkDB
Position
23
AA seq 193 aa
MGVPERPTLLFLLSLLLIALGLPVLCAPPRLICDSPVLERYILEAKEAENVTTMGCAEGP
RLSENITVPDTKVNFYAWKRMEVEEQAVDVWQGLSLLSEAILQARALLANSSQPPETLQL
HIDKAISGLRSLTSLLRVLGAQKELMSPPDTTPPAPLRTLTVDTFCKLFRVYANFLRGKL
KLYTGEVCRRGDR
NT seq 582 nt   +upstreamnt  +downstreamnt
atgggggtgcccgaacgtcccaccctgctgtttttactttccttgctactgattgctctg
ggcctcccagtcctctgtgctcccccacgcctcatctgcgacagtccagtcctggagagg
tacatcctggaggccaaggaggcagaaaatgtcaccacgatgggttgtgcggaaggtccc
cgactgagcgaaaatattacagtcccggacaccaaagtcaacttctatgcttggaaaaga
atggaggtggaagaacaggccgtagacgtttggcaaggcctgtccctgctctcagaagcc
atcctgcaggcccgggctctgctagccaattcctcccagccaccagagacccttcagctt
catatagacaaagccatcagtggtctacgtagcctcacgtcactgcttcgggtgctggga
gctcagaaggaactgatgtcgcctccagataccaccccacctgctccactccgaacactc
acagtggatactttctgcaagctcttccgggtctatgccaacttcctccgggggaaactg
aagctgtacacgggagaggtctgcaggaggggggacaggtga

KEGG   Mus pahari (shrew mouse): 110317099
Entry
110317099         CDS       T05929                                 

Gene name
Lep
Definition
(RefSeq) leptin
  KO
K05424  leptin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04080  Neuroactive ligand-receptor interaction
mpah04152  AMPK signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04920  Adipocytokine signaling pathway
mpah04932  Non-alcoholic fatty liver disease
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110317099 (Lep)
   04152 AMPK signaling pathway
    110317099 (Lep)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110317099 (Lep)
   04060 Cytokine-cytokine receptor interaction
    110317099 (Lep)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110317099 (Lep)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110317099 (Lep)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110317099 (Lep)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  CSF and other factors
   110317099 (Lep)
SSDB
Motif
Pfam: Leptin
Other DBs
NCBI-GeneID: 110317099
NCBI-ProteinID: XP_021047139
Ensembl: MGP_PahariEiJ_G0021919
LinkDB
Position
2
AA seq 167 aa
MCWRPLCRFLWLWSYLSYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGL
DFIPGLHPLLSLSKMDQTLAVYQQVLTSLPSQSVLQIANDLENLRDLLHLLAFSKSCSLP
QTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC
NT seq 504 nt   +upstreamnt  +downstreamnt
atgtgctggagacccctgtgccggttcctgtggctttggtcctatctgtcctatgttcaa
gctgtgcctatccagaaagtccaggatgacaccaaaaccctcatcaagaccattgtcacc
aggatcaatgacatctcacacacgcagtcggtatccgccaagcagagggtcactggcttg
gacttcattcctgggcttcaccctcttctgagtttgtccaagatggaccagactctggca
gtctatcaacaggtcctcaccagcctgccttcccaaagtgtgctacagatagccaacgac
ctggagaatctccgagacctcctccatctgctggccttctccaagagctgctccctgcct
cagaccagtggcctgcagaagccagaaagcctggatggcgtcctggaagcctcgctctac
tccacagaggtggtggctctgagcaggctgcagggctctctgcaggacattcttcaacag
ttggatgttagccctgaatgctga

KEGG   Mus pahari (shrew mouse): 110329913
Entry
110329913         CDS       T05929                                 

Gene name
Thpo
Definition
(RefSeq) thrombopoietin isoform X1
  KO
K06854  thrombopoietin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04630  JAK-STAT signaling pathway
mpah04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110329913 (Thpo)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110329913 (Thpo)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110329913 (Thpo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110329913 (Thpo)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  CSF and other factors
   110329913 (Thpo)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 110329913
NCBI-ProteinID: XP_021065510
Ensembl: MGP_PahariEiJ_G0016294
LinkDB
Position
12
AA seq 352 aa
MELTDLLLVAMLLLTARLTLSSPVPPACDPRLLNKLLRDSHLLHSRLSQCPDVNPLSIPV
LLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRL
LLGALQGLLGTQGRTTAHKDPSALFMSLQQLLRGKVRFLLLVEGPTLCVRRTLPATAGPS
RASQLLTLNKFPNRTSGWLETNFSVTARTTGPGLLNRLQGFRAKIIPGQLNQTSGSPDQI
PGYLNRTHGPVNGTHGLFAGTSLQTLEASDMAPGAFNKGSLALDLRGGLPPSPRLAPDGH
TLFPPSPTLPTHGSPPQLHPLFPDPSSTAMPNSTGPHPITMYPHSRNLSQEA
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggagctgactgatttgctcctggtggccatgcttctcctcaccgcaagactaactctg
tccagccctgttcctcctgcctgtgaccccagactcctaaataaactgctgcgtgactcc
cacctccttcacagccgactgagtcagtgtcctgacgtcaaccctttgtctatccctgtc
ctgctgcccgctgtggactttagcctgggagaatggaaaacccagacggaacagagcaag
gcacaggacattctaggggcagtgtcccttctactggagggagtgatggcagcacgagga
cagttggaaccctcctgcctctcatccctcttgggacagctttctgggcaggttcgcctc
ctcttgggggccctgcagggcctcctaggaacccagggcaggaccacagctcacaaggac
cccagtgccctcttcatgagcctgcaacagctgctgcggggaaaggtgcgcttcctgctt
ctggtagaaggtcccaccctctgtgtcagacggaccctgccagccacagctggcccaagc
agagcttctcagctcctcacactaaacaagttcccaaacaggacttctggatggttggag
acgaacttcagtgtcacagccagaaccactggccctggacttctgaacaggcttcaagga
ttcagagccaagattattcctggtcagctaaatcaaacctccgggtccccagaccaaatc
cctgggtacctgaacaggacacacggacctgtgaatggaactcatgggctctttgctgga
acctcacttcagaccctggaagcctcagacatggcaccaggagccttcaacaaaggctcc
ctggcactcgacctccggggtggacttcctccttctccgcgccttgctcctgatggacac
acactcttccctccctccccaaccttgcctacccatggatctccaccccagctccacccc
ctatttcctgacccttcttctaccgccatgcctaactctaccggccctcatccaatcaca
atgtaccctcattccaggaatttgtctcaggaagcatag

KEGG   Mus pahari (shrew mouse): 110332223
Entry
110332223         CDS       T05929                                 

Definition
(RefSeq) somatotropin
  KO
K05438  growth hormone
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04080  Neuroactive ligand-receptor interaction
mpah04151  PI3K-Akt signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110332223
   04151 PI3K-Akt signaling pathway
    110332223
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110332223
   04060 Cytokine-cytokine receptor interaction
    110332223
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    110332223
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110332223
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  CSF and other factors
   110332223
SSDB
Motif
Pfam: Hormone_1 DUF5798
Other DBs
NCBI-GeneID: 110332223
NCBI-ProteinID: XP_021068983
Ensembl: MGP_PahariEiJ_G0018449
LinkDB
Position
14
AA seq 216 aa
MATDSRTSWLLTFSLLCLLWPQEAGAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERA
YIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSR
IFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDAL
LKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF
NT seq 651 nt   +upstreamnt  +downstreamnt
atggctacagactctcggacctcctggctcctgaccttcagcctgctctgcctgctctgg
cctcaggaggctggtgcttttcccgccatgcccttgtccagtctgtttgccaatgctgtg
ctccgagcccagcacctgcaccagctggctgctgacacctacaaagagttcgagcgtgcc
tacattcccgagggacagcgctattccattcagaatgcccaggctgcgttctgcttctca
gagaccatcccagcccccacaggcaaggaggaggctcagcagagaactgacatggaattg
cttcgcttctcgctgctgctcatccagtcatggctggggcctgtgcagttcctcagcagg
atcttcaccaacagcctgatgtttggcacctcggaccgtgtctatgagaaactgaaggac
ctggaagagggcatccaggctctgatgcaggagctggaagatggcagcccccgtgttggg
cagatcctcaagcaaacctatgacaagtttgacgccaacatgcgcagtgatgacgcgctg
ctcaaaaactatgggctgctctcctgcttcaagaaggacctacacaaggcggagacctac
ctgcgggtcatgaagtgtcgccgcttcgtggaaagcagctgtgctttctag

KEGG   Mus pahari (shrew mouse): 110332564
Entry
110332564         CDS       T05929                                 

Gene name
Csf3
Definition
(RefSeq) granulocyte colony-stimulating factor
  KO
K05423  granulocyte colony-stimulating factor
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04151  PI3K-Akt signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04640  Hematopoietic cell lineage
mpah04657  IL-17 signaling pathway
mpah05144  Malaria
mpah05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110332564 (Csf3)
   04151 PI3K-Akt signaling pathway
    110332564 (Csf3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110332564 (Csf3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110332564 (Csf3)
   04657 IL-17 signaling pathway
    110332564 (Csf3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    110332564 (Csf3)
  09174 Infectious disease: parasitic
   05144 Malaria
    110332564 (Csf3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110332564 (Csf3)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  CSF and other factors
   110332564 (Csf3)
SSDB
Motif
Pfam: GCSF IL6 IL11
Other DBs
NCBI-GeneID: 110332564
NCBI-ProteinID: XP_021069494
Ensembl: MGP_PahariEiJ_G0018223
LinkDB
Position
14
AA seq 208 aa
MAQLSAQRRMKLMALQLLLWHSALWSGREAVPLVTVSSLPPSPPLPRSFLLKSLEQVRKI
QASGVVLLQRLCATYKLCHPEELVLLGHSLGIPKASLSSCSSQALQQTKCLSQLHNGLFL
YQGLLQALAGISPALAPTLDLLQLDVANFATTIWQQMENLEVAPPVQPTQSAMPAFTSAF
QRRAGGVLATSYLQSFLETARHALHHMA
NT seq 627 nt   +upstreamnt  +downstreamnt
atggctcaactttctgcccagaggcgcatgaagctaatggccctgcagctgctgctgtgg
cacagtgcactatggtcaggacgagaggccgttcccctggtcactgtcagctctctgcca
ccatccccgcctttgccccgaagcttcctgcttaagtctctggagcaagtgagaaagatc
caggccagcggtgtggtgctgctgcagcggttgtgtgccacctacaaactgtgtcacccc
gaggagctggtgttgctgggccactctctggggatcccgaaggcttccctgagtagctgc
tccagccaggccctgcagcagacaaagtgcctgagccagctccacaatgggctcttcctc
taccaaggtctcctgcaggccctagcgggcatttcccctgccttggcccccaccttggat
ttgcttcagctggatgttgccaactttgccaccaccatctggcagcagatggaaaaccta
gaggtggcccctcctgtgcaacccacgcagagcgccatgccagccttcacttctgccttc
cagcgccgggcaggaggtgtcctggccacttcgtacctgcagagctttctggagacagct
cgccatgctctgcaccacatggcctag

KEGG   Mus pahari (shrew mouse): 110333583
Entry
110333583         CDS       T05929                                 

Definition
(RefSeq) prolactin-6A1
  KO
K05439  prolactin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04080  Neuroactive ligand-receptor interaction
mpah04151  PI3K-Akt signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110333583
   04151 PI3K-Akt signaling pathway
    110333583
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110333583
   04060 Cytokine-cytokine receptor interaction
    110333583
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    110333583
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110333583
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  CSF and other factors
   110333583
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 110333583
NCBI-ProteinID: XP_021070848
Ensembl: MGP_PahariEiJ_G0019432
LinkDB
Position
16
AA seq 230 aa
MLSLSQPCFWTLLMLLVASNFLLWKNVASVPMYASLAEYAEMSIYDLLDHGAILSHNVSE
LTAEMHRIFMEDVRYKPGRWFSDRYLTACHTSTLTISVSKEGAQQLPGVFLVKEMISMLE
SWRYPLYHIATELSYMEQAPDEIISRARNIEEKIIVLTDVLRGILSKIQHGPPENERYPM
WNELSSLKSPDEDLRHLTLFNLFQCLVKDTRKIDSSLRLLKCKLLYNRDC
NT seq 693 nt   +upstreamnt  +downstreamnt
atgctgtctttgagtcaaccttgcttctggactctcctgatgctcttggtggcgtcaaac
ttccttctatggaagaatgtagcctctgtgcccatgtatgccagtttggctgaatatgca
gagatgtctatatatgacctgcttgatcatggtgccatactatctcataatgtcagtgag
ctcactgcagaaatgcacaggatatttatggaggatgttcgatataaaccaggcaggtgg
ttctctgacagataccttactgcctgccacacatctacattgactatttcagtgtctaag
gagggagcccagcagttgccgggtgtattccttgtgaaagagatgatcagtatgttggaa
tcttggagatatcctctgtatcacatagcaactgaactgagttatatggagcaagcccct
gatgagatcatatcaagagccagaaatattgaagaaaaaatcatagtgcttacagatgtt
cttagagggatactcagcaagattcagcatggacccccagaaaacgagagatatcccatg
tggaatgaactgtcatccttgaagtcacctgatgaagaccttcgccatcttactttgttt
aacttattccagtgcttggtcaaagatacacgtaagattgactctagtctcaggcttttg
aagtgtaaacttctctataacagagattgttaa

KEGG   Mus pahari (shrew mouse): 110333863
Entry
110333863         CDS       T05929                                 

Definition
(RefSeq) prolactin-2C2-like isoform X1
  KO
K05439  prolactin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04080  Neuroactive ligand-receptor interaction
mpah04151  PI3K-Akt signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110333863
   04151 PI3K-Akt signaling pathway
    110333863
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110333863
   04060 Cytokine-cytokine receptor interaction
    110333863
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    110333863
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110333863
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  CSF and other factors
   110333863
SSDB
Motif
Pfam: Hormone_1 PMC2NT Laminin_I
Other DBs
NCBI-GeneID: 110333863
NCBI-ProteinID: XP_021071280
Ensembl: MGP_PahariEiJ_G0019445
LinkDB
Position
16
AA seq 228 aa
MQLSLTQPSSWILLLLVVTSLLLWKNVASVPMCAMRNARCFTFFEDTFELAGSLSHNISI
EVSELFTDFENHYAKVPGLRDKSLMRCHTSFLSTPENKEQARHTHYEALLKSADMILDVW
ESPLNDLVSELSTIKNVPDTIISKATDIKKKINAVQKGVNSLISSMLQNGDEEKKNPAWS
RLPLLQSNNEDAHIRSLYGMISCLDNDFKKVDIYLNVLKCYMLKIDNC
NT seq 687 nt   +upstreamnt  +downstreamnt
atgcagctgtcattgacgcaaccaagttcctggatactgctcctactggtggtgaccagc
ttgctcttgtggaagaatgtcgcatcagtgcccatgtgtgcaatgaggaatgctcgttgc
ttcacattctttgaagacacatttgaattagccggcagtttgtctcataatatcagcata
gaagtttcagaactgttcactgattttgaaaaccattatgctaaagtgcctgggctcaga
gacaaaagcctcatgagatgccatacttctttcctctccactccagaaaacaaggaacaa
gccaggcacacacactatgaagctcttctgaaatcagcggacatgattttggatgtctgg
gaaagccctctgaatgatctagtgagtgaactatctaccataaaaaatgtcccggatact
atcatctccaaagccacagacataaagaaaaagatcaacgcagtccagaagggggttaat
tccctcataagcagcatgcttcagaatggagatgaagaaaagaagaaccctgcctggtcc
agactgccactcttacaatccaacaatgaagatgctcacattcgttctttatatggcatg
atcagctgcctagacaatgactttaagaaggttgatatttatctcaatgtcctgaagtgt
tacatgttaaaaatagataactgctga

KEGG   Mus pahari (shrew mouse): 110333918
Entry
110333918         CDS       T05929                                 

Definition
(RefSeq) prolactin isoform X1
  KO
K05439  prolactin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04080  Neuroactive ligand-receptor interaction
mpah04151  PI3K-Akt signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110333918
   04151 PI3K-Akt signaling pathway
    110333918
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110333918
   04060 Cytokine-cytokine receptor interaction
    110333918
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    110333918
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110333918
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  CSF and other factors
   110333918
SSDB
Motif
Pfam: Hormone_1 Lipl32 DUF4130
Other DBs
NCBI-GeneID: 110333918
NCBI-ProteinID: XP_021071361
Ensembl: MGP_PahariEiJ_G0019425
LinkDB
Position
16
AA seq 228 aa
MTMNSQGSARKAGTLLLLLMSNLLFCQNVQPMPICHSDDCQTPLPELFDRVVMLSHYIHT
LYTDMFIEFDRQYVHDRELIAKAFNGCPTSSLATPEDKEQALKVPPEVLLNLILSLVHSW
SDPLFQLITGVGGIHEAPDAILSRAKEIEEQNKRLLEGVEKIISQAYPEAKGNGIYFVWS
QLPSLQGVDKESKVLELHNTIRCLRRDSHKVDNFLKFLRCQIVHKNNC
NT seq 687 nt   +upstreamnt  +downstreamnt
atgaccatgaacagccaggggtcagcccggaaagcagggacactcctcctgctgctgatg
tcaaacctgctgttctgccaaaatgtgcagcctatgccaatctgccacagtgatgactgc
cagacgcctctaccggagctgtttgaccgtgtggtcatgctttctcactacatccatacc
ctgtatacagatatgttcattgaatttgataggcagtatgtgcatgaccgtgagctcatt
gccaaggccttcaatggctgccccacttcttccctggctactcctgaagacaaggaacaa
gccctgaaagtccccccggaagttcttctcaacctgatcctcagtttggtgcactcctgg
agtgaccctctgtttcaactaataactggagtaggtggtattcatgaagcccctgatgcc
atcttatcaagagccaaagagatcgaggaacaaaacaagcggcttcttgagggggttgag
aagataattagccaggcctatcctgaagcgaaaggaaatgggatctactttgtttggtca
caacttccatccctgcagggagttgacaaagaatccaaagtcttggaattgcataacacc
attcgctgcctgcgcagggattcccacaaggtggacaattttctcaagttcctgaggtgc
caaattgtccataaaaacaactgctaa

KEGG   Mus pahari (shrew mouse): 110334155
Entry
110334155         CDS       T05929                                 

Definition
(RefSeq) prolactin-2A1
  KO
K05439  prolactin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04080  Neuroactive ligand-receptor interaction
mpah04151  PI3K-Akt signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110334155
   04151 PI3K-Akt signaling pathway
    110334155
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110334155
   04060 Cytokine-cytokine receptor interaction
    110334155
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    110334155
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110334155
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  CSF and other factors
   110334155
SSDB
Motif
Pfam: Hormone_1 DUF3102
Other DBs
NCBI-GeneID: 110334155
NCBI-ProteinID: XP_021071675
Ensembl: MGP_PahariEiJ_G0019444
LinkDB
Position
16
AA seq 228 aa
MQLSVTHPCCRTLLLLLVSNLLLWESEAVMPICSVRNGRCFGSFEEMLERAVSLSEEISK
KAFELFTAFDSQYAQSHQLINKNLKKCHTSSLELPKPGSQAVQTHPVTLLKLASKLLRAW
QVPLNHLVNNLPSLKDISPTILSKAKEIEEKSTGLLEGVKSILIQMQNGDTEDENYPGWS
GLASLKSETEDNRLFAYYNMIRCEGRDTQKVETALKMVKCKISNKNNC
NT seq 687 nt   +upstreamnt  +downstreamnt
atgcagctatctgtaactcatccttgctgcaggaccctgcttctgctactggtgtctaac
ctgcttctgtgggagagtgaggccgtgatgcccatatgctcagtaaggaatggacgctgc
tttggttcctttgaagaaatgcttgaaagagctgtcagtttgtctgaagagataagtaaa
aaagcctttgaactcttcactgcatttgatagtcagtatgcccagagccaccagctcatt
aacaagaacctcaaaaaatgtcacacatcttctctcgaacttccaaaaccagggagtcaa
gccgtgcagacacatcctgtaaccctactgaaattagcaagcaaattattgagagcctgg
caagtccctttgaaccatctagtgaacaacctgccatccttgaaagacatctctcctact
atcctctccaaagccaaagagattgaggaaaagagcactggactcctggagggagttaag
agcattctcatccaaatgcaaaatggagatacagaagatgagaactaccctggctggtct
ggactggcatccttgaagtcagagactgaagataatcgcctctttgcatattacaacatg
atccgctgtgagggcagagacactcagaaggttgaaactgctctcaagatggtgaagtgc
aaaatttcaaataaaaacaactgctga

KEGG   Mus pahari (shrew mouse): 110334192
Entry
110334192         CDS       T05929                                 

Definition
(RefSeq) prolactin-5A1
  KO
K05439  prolactin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04080  Neuroactive ligand-receptor interaction
mpah04151  PI3K-Akt signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110334192
   04151 PI3K-Akt signaling pathway
    110334192
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110334192
   04060 Cytokine-cytokine receptor interaction
    110334192
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    110334192
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110334192
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  CSF and other factors
   110334192
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 110334192
NCBI-ProteinID: XP_021071715
Ensembl: MGP_PahariEiJ_G0019450
LinkDB
Position
16
AA seq 230 aa
MRLSKIQPHPAGALLLLLLSNLLMWENVVSVPRCIMEDGGCQKVLNYIFNMSSTISENFN
NLSSETLNDFDTEYDPHQKFQNRPTMTCHTSSRSIPNNKRKAERMQPVVLLNVTMRMLAA
WKNLLCYVENNMADLDGTPYAIISKVKLIDRQIKKLTKNLQDIKTILSQVHPELKENEDY
PAWSGEPYVQQSKRRIQLFGLHSLFVCLDNDAQKVSDFINILRVQIVPNQ
NT seq 693 nt   +upstreamnt  +downstreamnt
atgcggctgtctaagattcaaccacaccctgcaggggcacttctgctgctgttgctgtca
aacttgctcatgtgggagaatgtggtctctgtacccagatgtatcatggaagatggaggt
tgccagaaagtcctcaactacatttttaacatgtcaagcaccatatctgagaacttcaac
aacctctcttcagaaacattaaatgattttgatacagagtatgatccacaccagaaattc
cagaacaggcccaccatgacttgtcacacttcatcccgctctatcccaaacaacaaaagg
aaggctgaaagaatgcagcctgtggtacttctgaatgtgacaatgagaatgctggctgcc
tggaaaaaccttctgtgctatgtagaaaacaacatggctgatctcgatggaactccttat
gctatcatatcaaaagttaagttgattgacagacaaatcaagaaactcactaaaaatctg
caggacattaagactatactcagccaggttcatcctgaacttaaggaaaatgaggactac
cctgcctggtcaggagagccatatgtacagcaatcaaaaagaagaattcagctttttggt
ttgcatagtttgtttgtctgcttggacaatgatgcacagaaggtttctgatttcatcaat
atcctgagagtccaaattgtgcctaatcaatga

KEGG   Mus pahari (shrew mouse): 110338866
Entry
110338866         CDS       T05929                                 

Gene name
Cntf
Definition
(RefSeq) LOW QUALITY PROTEIN: ciliary neurotrophic factor
  KO
K05420  ciliary neurotrophic factor
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110338866 (Cntf)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110338866 (Cntf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110338866 (Cntf)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  CSF and other factors
   110338866 (Cntf)
SSDB
Motif
Pfam: CNTF Neurexophilin
Other DBs
NCBI-GeneID: 110338866
NCBI-ProteinID: XP_021077995
Ensembl: MGP_PahariEiJ_G0014252
LinkDB
Position
1
AA seq 196 aa
MAFAEQSPXHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNISLDSVDGVPVASTD
RWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLTLQVSAFAYQ
LEELMVLLEQKVPEKEAEGMPVTTGNGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSH
HMGISAHENHYGAKQM
NT seq 591 nt   +upstreamnt  +downstreamnt
atggctttcgcagagcaatcacctnntcaccggcgggacctctgtagccgctctatctgg
ctagcaaggaagattcgttcagacctgactgctcttatggaatcttatgtaaaacatcag
ggcctgaataaaaatatcagccttgactcagtggatggtgtaccagtggcaagcactgat
cgctggagtgagatgactgaggcagagcgactccaagagaacctccaggcttaccgtacc
ttccaagggatgttaaccaagcttttagaagaccagagagtgcatttcaccccaactgaa
ggtgacttccatcaggcaatacatactcttacgctccaagtttctgccttcgcctaccag
ctagaggagttaatggtgcttctggaacaaaaggtccccgaaaaagaggctgaggggatg
cctgtcacaactggaaatggtggcctctttgagaagaagctgtggggcttgaaggtcctt
caagagctttcacagtggactgtgaggtctatccatgacctccgtgtcatttcttctcat
cacatgggaatctcagcacatgagaaccattatggggccaagcaaatgtag

DBGET integrated database retrieval system