KEGG   Mus pahari (shrew mouse): 110313316
Entry
110313316         CDS       T05929                                 

Gene name
Amot
Definition
(RefSeq) angiomotin
  KO
K16819  angiomotin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04390  Hippo signaling pathway
mpah04530  Tight junction
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110313316 (Amot)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110313316 (Amot)
SSDB
Motif
Pfam: Angiomotin_C
Other DBs
NCBI-GeneID: 110313316
NCBI-ProteinID: XP_021043022
Ensembl: MGP_PahariEiJ_G0032018
LinkDB
Position
X
AA seq 1131 aa
MRSSDDQPSGGTTVLQRLLQEQLRYGNPSENRSLLAIHQQATGNSSPFSTGSGNPGPQND
VLSSQDHHQQQLVAHPARQEPQGQEIQSENGVMEKQLSPRMQNNEELPTYEEAKVQSQYF
RGQQHASVGAAFYVTGVTNQKMRTEGRPSVQRLTPGKMHQDEGLRDLKQGHVRSLSERLM
QMSLATSGVKAHPPVTSAPLSPPQPNDLYKNATSSSEFYKAQGPPPSQHSLKGMEHRGPP
PEYPFKGVPSQSVVCKSQEPGHFYSEHRLNQPGRTEGQLMRYQHPPEYGAARATQDISSL
SLSARNTQPHSPSSSLTAGASSLPLLQSPPSARLPPGQHALVSNQGDHSAHLSRHQQHLL
SSQSHQGDHYRHAQANLTSAQQQQPGEAYSAMPRAQQSASYQPMPADPFAIVSRAQQMVE
ILSDENRNLRQELDGCYEKVARLQKVETEIQRVSEAYENLVKSSSKREALEKAMRNKLEG
EIRRMHDFNRDLRDRLETANKQLAEKEYEGSEDTRKTISQLFAKHKENQREKEKLEAELA
TARSTNEDQRRHIEIRDQALSNAQAKVVKLEEELKKKQVYVDKVEKMQQALVQLQAACEK
REQLEHRLRTRLERELESLRIQQRQGNSQPTNASEYNAAALMELLREKEERILALEADMT
KWEQKYLEENVMRHFALDAAATVAAQRDTTVISHSPNTSYDTALEARIQKEEEEILMANK
RCLDMEGRIKTLHAQIIEKDAMIKVLQQRSRKEPSKTEQLSSMRPAKSLMSISNAGSGLL
AHSSTLTGAPIMEEKRDDKSWKGSLGILLGGDYRAEPVPSTPSPVPPSTPLLSAHSKTGS
RDCSTQTERGSESTKTAAVTPISAPMAGPVAAAAPAAAIIATAATNTATAATNTTIMVAA
APVAVAAAAAPAAAAATPSPANAAALAAAATPATSVSAATSVSAANSISPAAPVTPAAVV
PPAAPVSPAAVVQIPAAVSLTPATVSPTPATATAAVAAATTAAATAAAAAAAAATTAIQV
APATSAPVPSPASIPAPATAQASAPTPTQASTPAPTEPPSPVPTPTPALVQTEGPANPGA
SSGPRRLSTPNLMCNPDKPDAPAFHSSTLERKTPIQILGQEPDAEMVEYLI
NT seq 3396 nt   +upstreamnt  +downstreamnt
atgagaagttctgacgatcagccaagcggaggaaccacggtactgcaacgcctgcttcaa
gagcagcttcgctatggcaatcccagtgagaatcgtagtctgcttgccatacaccagcaa
gccacagggaatagctctccattttccacgggcagtgggaatccaggtcctcagaatgat
gtattgagttcccaggatcatcaccagcagcagcttgtggcacaccctgctcgccaagaa
ccccagggtcaggaaatccagtcagaaaacggcgtcatggagaagcagctgtcccctcga
atgcagaataacgaagaactcccaacctacgaagaagccaaggtccagtcccagtacttc
aggggccaacagcatgctagtgttggggctgctttctatgtcacgggagtcaccaaccag
aagatgagaaccgagggacgcccatcagtccagcgcctcacgcctgggaagatgcaccaa
gatgaaggccttcgagatcttaagcaagggcatgttagatccttgagcgaaagactgatg
cagatgtcattggctaccagtggagttaaagcccacccgcctgttaccagtgctccactt
tccccaccacaacccaatgatctctacaagaatgccaccagttccagtgaattctacaag
gcccaagggccacctccaagccaacatagtctgaagggcatggaacaccgaggcccccca
ccagaataccctttcaagggcgtgccatcccagtcggtagtgtgcaagtcccaagagcca
gggcacttctatagtgagcatcgcctgaaccagccagggagaacagaggggcaactgatg
aggtatcagcatccccctgagtatggggcagccagggcaacacaggacatctcctcgctg
tctttgtcagccaggaacactcaacctcacagccctagttcttccctgacagctggggct
tccagcttgcccttgctgcagtctccaccatccgctagattgcctcccggtcaacacgcc
ctggtctcgaaccaaggtgaccactctgctcacctgtcaaggcatcagcagcatcttctt
tcaagtcagagtcatcagggggaccactaccgtcacgcccaggccaacctgacttcagcg
cagcagcagcagccgggagaagcctactcagctatgcctcgggctcagcagtctgcttct
tatcagcccatgccagctgacccttttgctatcgtctcaagagctcagcagatggttgag
atcctttctgatgagaatcgcaacttgcgacaggagttagatggatgctatgagaaggtg
gcgagactgcagaaggtggagacagaaatccaacgggtctcagaggcatatgagaacttg
gtgaagtcatcttccaaaagagaggctctggagaaagccatgaggaacaagctggagggt
gagatcagaaggatgcatgacttcaacagagatctaagagaccgtctagagactgccaac
aagcagctggcagagaaggagtacgaggggtctgaggacaccaggaagaccatctctcag
ctctttgccaaacataaagaaaaccagcgggagaaggagaagctggaagctgaactggct
actgcccgttctaccaatgaagaccaaaggcgacacattgaaatccgagaccaggcattg
agcaatgcccaggcgaaggtggtgaagctggaagaagagctgaaaaagaagcaagtgtat
gtagataaggtggagaagatgcagcaggcccttgtgcagctccaggccgcatgtgagaag
cgtgagcagctggaacaccggctccggacacgtttggagagggaattggaatcccttcga
atccagcagcgccagggcaactcccagcccactaatgcttcagaatacaatgctgctgca
ctgatggagctcctccgggagaaggaggagagaattctggccctggaagcagatatgacc
aagtgggagcaaaagtatttggaagagaatgtgatgagacactttgctctggatgctgct
gcaactgtggctgcgcagagagacacaacagtcattagccactctcctaacaccagctac
gacacagccttagaggcccggatccagaaggaagaagaggaaatcctgatggccaacaaa
cgttgcttggacatggaaggaaggattaagaccctccatgcccagattattgaaaaggat
gccatgatcaaggtgctgcagcagcgctccagaaaggagccgagtaagacagagcaactc
tcatccatgcggccagcaaagtctctgatgtccatttccaatgctggatcaggcctgctt
gcacactcatctaccttgactggtgcgcccattatggaggagaagcgtgatgacaagagc
tggaaggggagcctaggcattcttctgggaggagactaccgtgctgagcctgtcccatcc
acaccttcccctgtgcctccatctactccccttctctcagctcattcgaagacaggcagt
cgagactgcagcacccaaactgaacgtggatcggaatcgaccaaaaccgcggctgtcact
cccatctcggctccaatggctggtccagttgctgctgctgcccctgctgctgccatcatt
gcaactgctgccaccaacactgccactgctgccaccaacaccactatcatggtagctgct
gctccagttgctgttgctgctgctgctgctccagctgctgctgctgccaccccatctcca
gcaaacgctgctgctcttgctgctgctgccactccagctacttctgtctctgcagctact
tctgtctctgcagctaattctatctctccagctgctcctgtcactccagctgctgtagtg
cctccagctgcacctgtctcaccagctgctgttgttcagattccagctgctgtatctctt
actcctgctactgtttctccaactcctgccactgctactgctgctgttgctgcagctact
actgctgctgccactgctgctgccgctgctgctgctgctgccactactgctattcaggtt
gctccagctacttcggctccggttccatctccagcttcgattccggctccagcaacggct
caggcttctgctccgactccgactcaggcatcaactccagctccgactgaacctcctagt
ccagttccaactccaactccagctttggttcaaactgagggtcctgcaaatccaggtgcc
agttccggaccacgccgcttgtctacaccaaatctgatgtgcaacccagataagccagat
gcccctgctttccactccagcactctggaaagaaagacacccattcagatcctggggcaa
gagcctgatgcagagatggtggaatatctcatctaa

DBGET integrated database retrieval system