KEGG   Mus pahari (shrew mouse): 110313464
Entry
110313464         CDS       T05929                                 

Gene name
Ikbkg
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01523  Antifolate resistance
mpah04010  MAPK signaling pathway
mpah04014  Ras signaling pathway
mpah04062  Chemokine signaling pathway
mpah04064  NF-kappa B signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04210  Apoptosis
mpah04380  Osteoclast differentiation
mpah04620  Toll-like receptor signaling pathway
mpah04621  NOD-like receptor signaling pathway
mpah04622  RIG-I-like receptor signaling pathway
mpah04623  Cytosolic DNA-sensing pathway
mpah04625  C-type lectin receptor signaling pathway
mpah04657  IL-17 signaling pathway
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah04660  T cell receptor signaling pathway
mpah04662  B cell receptor signaling pathway
mpah04668  TNF signaling pathway
mpah04920  Adipocytokine signaling pathway
mpah05132  Salmonella infection
mpah05135  Yersinia infection
mpah05142  Chagas disease
mpah05145  Toxoplasmosis
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05162  Measles
mpah05163  Human cytomegalovirus infection
mpah05164  Influenza A
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05200  Pathways in cancer
mpah05203  Viral carcinogenesis
mpah05212  Pancreatic cancer
mpah05215  Prostate cancer
mpah05220  Chronic myeloid leukemia
mpah05221  Acute myeloid leukemia
mpah05222  Small cell lung cancer
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mpah05340  Primary immunodeficiency
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110313464 (Ikbkg)
   04014 Ras signaling pathway
    110313464 (Ikbkg)
   04064 NF-kappa B signaling pathway
    110313464 (Ikbkg)
   04668 TNF signaling pathway
    110313464 (Ikbkg)
   04151 PI3K-Akt signaling pathway
    110313464 (Ikbkg)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110313464 (Ikbkg)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110313464 (Ikbkg)
   04621 NOD-like receptor signaling pathway
    110313464 (Ikbkg)
   04622 RIG-I-like receptor signaling pathway
    110313464 (Ikbkg)
   04623 Cytosolic DNA-sensing pathway
    110313464 (Ikbkg)
   04625 C-type lectin receptor signaling pathway
    110313464 (Ikbkg)
   04660 T cell receptor signaling pathway
    110313464 (Ikbkg)
   04658 Th1 and Th2 cell differentiation
    110313464 (Ikbkg)
   04659 Th17 cell differentiation
    110313464 (Ikbkg)
   04657 IL-17 signaling pathway
    110313464 (Ikbkg)
   04662 B cell receptor signaling pathway
    110313464 (Ikbkg)
   04062 Chemokine signaling pathway
    110313464 (Ikbkg)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110313464 (Ikbkg)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110313464 (Ikbkg)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110313464 (Ikbkg)
   05203 Viral carcinogenesis
    110313464 (Ikbkg)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110313464 (Ikbkg)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110313464 (Ikbkg)
   05221 Acute myeloid leukemia
    110313464 (Ikbkg)
   05220 Chronic myeloid leukemia
    110313464 (Ikbkg)
   05215 Prostate cancer
    110313464 (Ikbkg)
   05222 Small cell lung cancer
    110313464 (Ikbkg)
  09163 Immune disease
   05340 Primary immunodeficiency
    110313464 (Ikbkg)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110313464 (Ikbkg)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110313464 (Ikbkg)
   05135 Yersinia infection
    110313464 (Ikbkg)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110313464 (Ikbkg)
   05170 Human immunodeficiency virus 1 infection
    110313464 (Ikbkg)
   05162 Measles
    110313464 (Ikbkg)
   05164 Influenza A
    110313464 (Ikbkg)
   05161 Hepatitis B
    110313464 (Ikbkg)
   05160 Hepatitis C
    110313464 (Ikbkg)
   05168 Herpes simplex virus 1 infection
    110313464 (Ikbkg)
   05163 Human cytomegalovirus infection
    110313464 (Ikbkg)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110313464 (Ikbkg)
   05169 Epstein-Barr virus infection
    110313464 (Ikbkg)
   05165 Human papillomavirus infection
    110313464 (Ikbkg)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110313464 (Ikbkg)
   05142 Chagas disease
    110313464 (Ikbkg)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    110313464 (Ikbkg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110313464 (Ikbkg)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   110313464 (Ikbkg)
SSDB
Motif
Pfam: NEMO CC2-LZ zf_C2H2_10 ERM LLC1 DpnI_C
Other DBs
NCBI-GeneID: 110313464
NCBI-ProteinID: XP_021043382
Ensembl: MGP_PahariEiJ_G0031730
LinkDB
Position
X
AA seq 424 aa
MRYLENGTLSCWMNKHLWKNQLSEMVQPSGGPAEDQDMLGEESSLGKPAMLHLPSEQGTP
ETLQRCLEENQELRDAIRQSNQMLRERCEELLHFQVSQREEKEFLMCKFQEARRLVERLS
LEKLDLRSQREQALKDLEHLKKCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKERQ
TLEGRIRAVSEQVRQLESEREVLQQQHSVQVDQLRMQNQSVEAALRMERQAASEEKRKLA
QLQAAYHQLFQDYDSHIKSSKGTQLEDLRQQLQQAEEALVAKQELIDKLKEEAEQHKIVM
ETVPVLKAQADIYKADFQAERHAREKLVERKEFLQEQLEQLQREFNKLKVGCHESARIED
MRKRHVETSQPPLLPAPAHHSFHLALSNQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVM
ECIE
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgcggtaccttgaaaatgggacactgtcttgttggatgaacaagcacctctggaagaat
cagctgagtgagatggtgcagcccagtggtggcccagcagaggaccaggacatgctgggt
gaagaatcttctctggggaagcctgcaatgctacatctaccttcagagcagggtactcct
gagaccctccagcgctgtctggaagagaatcaagagctccgagatgctatccggcagagc
aatcagatgctgagggagcgctgtgaggagctgctgcatttccaggtcagccagcgggag
gagaaggagttccttatgtgcaaattccaggaagccaggaggctggtggagagactgagc
ttggagaagcttgatcttcggagtcagagggaacaggccttaaaggatttggagcacctg
aagaaatgccaacagcagatggctgaggacaaggcctctgtgaaagctcaggtgacatca
ttgcttggagaactccaggagagccagagtcgtttggaggctgccaccaaggaacggcaa
actttagagggaaggattcgagcagttagtgagcaggtcagacagttggagagtgagcgg
gaggtgttacagcagcagcacagtgtccaggtggaccagctgcgcatgcagaaccagagt
gtggaggctgccttgcgaatggagcgacaggctgcttcagaggagaaacggaagctggct
cagttgcaggcagcctatcatcagctcttccaagactatgacagccacattaagagcagc
aagggcacgcagctggaagatctgaggcaacagctccagcaagctgaggaggccctggta
gccaaacaggaattgattgataagctgaaagaggaggctgagcagcacaagattgtgatg
gagactgtgccagtcttgaaggcccaggcggatatctacaaggctgacttccaagctgag
aggcatgcccgggagaagctggtggagaggaaggagtttttgcaggagcagctggagcag
ctgcagcgcgagttcaacaaactgaaagttggctgccatgagtcagccaggattgaggat
atgaggaagcggcatgtagagacttcccagccccctttactccctgctccagctcaccac
tcctttcatttggctttgtccaaccagcggaggagccctcctgaagaacctcctgacttc
tgttgtcccaagtgccagtatcaggctcctgatatggacactctacagatacatgtcatg
gagtgcatagagtag

DBGET integrated database retrieval system