KEGG   Mus pahari (shrew mouse): 110313534
Entry
110313534         CDS       T05929                                 

Gene name
Fhl1
Definition
(RefSeq) four and a half LIM domains protein 1 isoform X1
  KO
K14365  four and a half LIM domains protein 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110313534 (Fhl1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mpah04990]
    110313534 (Fhl1)
Domain-containing proteins not elsewhere classified [BR:mpah04990]
 LIM domain-containing proteins
  FHL family proteins
   110313534 (Fhl1)
SSDB
Motif
Pfam: LIM Ureidogly_lyase
Other DBs
NCBI-GeneID: 110313534
NCBI-ProteinID: XP_021043555
Ensembl: MGP_PahariEiJ_G0031632
LinkDB
Position
X
AA seq 339 aa
MASQRHSGPSSYKVGTMSEKFDCHYCRDPLQGKKYVQKDGRHCCLKCFDKFCANTCVECR
KPISADAKEVHYKNRYWHDTCFRCAKCLHPLASETFVSKDGKILCNKCATREDSPRCKGC
FKAIVAGDQNVEYKGTVWHKDCFTCSNCKQVIGTGSFFPKGEDFYCVTCHETKFAKHCVK
CNKAITSGGITYQDQPWHAECFVCVTCSKKLAGQRFTAVEDQYYCVDCYKNFVAKKCAGC
KNPITGKRTVSRVSHPVSKARKSPVCHGKRLPLTLFPSANLRGRHPGGERTCPSWVVVLY
RKNRSLAAPRGPGLVKAPVWWPMKDNPGTTTASTAKNAP
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggcttctcaaagacactcaggtccctccagctataaggtgggcaccatgtcggagaag
ttcgactgtcactactgcagggaccccttgcaggggaagaagtacgtgcagaaggatggc
cgtcactgctgcctgaagtgctttgacaagttctgcgccaacacctgtgtggaatgccgc
aagcccataagcgctgatgccaaggaggtgcattataagaatcgctactggcacgacacc
tgcttccgctgtgccaagtgccttcaccccttggccagtgagacctttgtgtccaaggat
ggcaagatcctgtgcaacaagtgcgccactcgggaggactcccccaggtgcaaagggtgc
ttcaaggccattgtggcaggagaccagaacgtggagtacaagggcaccgtctggcataaa
gactgcttcacctgcagcaactgcaagcaagtcattgggaccggaagcttcttcccaaaa
ggggaggacttctattgtgtgacttgccatgagaccaagttcgccaagcattgcgtgaag
tgcaacaaggccatcacatctggaggaatcacttaccaggatcagccctggcatgccgag
tgctttgtgtgtgttacctgctctaagaagctggctgggcagcgtttcaccgctgtggag
gaccagtattactgcgtggattgctacaagaactttgtggccaagaagtgtgctggatgc
aagaaccccatcactgggaaaaggactgtgtcaagagtgagccacccagtctctaaagct
aggaagtccccagtgtgccacgggaaacgcttgcctctcaccctgtttcccagcgccaac
ctccggggcaggcatccgggtggagagaggacttgtccctcgtgggtggtggttctttat
agaaaaaatcgaagcttagcagctcctcgaggcccgggtttggtaaaggctccagtgtgg
tggcctatgaaggacaatcctggcacgactactgcttccactgcaaaaaatgctccgtga

DBGET integrated database retrieval system