KEGG   Mus pahari (shrew mouse): 110313659
Entry
110313659         CDS       T05929                                 

Gene name
Il13ra1
Definition
(RefSeq) interleukin-13 receptor subunit alpha-1
  KO
K05076  interleukin 13 receptor alpha-1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04630  JAK-STAT signaling pathway
mpah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110313659 (Il13ra1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110313659 (Il13ra1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110313659 (Il13ra1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110313659 (Il13ra1)
   04090 CD molecules [BR:mpah04090]
    110313659 (Il13ra1)
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  IL3 receptor family
   110313659 (Il13ra1)
CD molecules [BR:mpah04090]
 Proteins
  110313659 (Il13ra1)
SSDB
Motif
Pfam: Il13Ra_Ig IL6Ra-bind fn3 EpoR_lig-bind LIFR_D2 LIFR_N Pox_EPC_I2-L1
Other DBs
NCBI-GeneID: 110313659
NCBI-ProteinID: XP_021043776
Ensembl: MGP_PahariEiJ_G0031528
LinkDB
Position
X
AA seq 424 aa
MARPALLGELLVLLLWTATVGQVAAATEVQPPVTNLSVSVENLCTIIWTWSPPEGASPNC
SLRYFSHFDDQQDKKIAPETHRKEELPLDEKICLQVGSQCSANESEKPSPLVKKCISPPE
GDPESAVTELKCIWHNLSYMKCSWLPGRNTSPDTNYTLYYWYSSLEKSLQCENIYREGQH
IACSFKLTKVKPSFEHHNVQIMVKDNAGKIRPSCKIVSLTSYVKPDPPHIKHLLLKNGAL
LVQWKNPQNFRSRCLTYEVEVNNTQTDRHNILEVEEDKCQNSESDRNTEGASCFLFPGVL
ADTVYTVRVRVKTNKLCFDDNKLWSDWSEAQSIGKERNSTFYTTMLLIIPVFVAVAVIIL
LFYLKRLKIIIFPPIPDPGKIFKEMFGDQNDDTLHWKKYDIYEKQSKEETDSVVLIENLK
KAAP
NT seq 1275 nt   +upstreamnt  +downstreamnt
atggcgcggccagcgctgctgggcgagctgttggtgctgctactgtggaccgccaccgtg
ggccaagttgccgcagccacagaagttcagccacctgtgacaaatttgagcgtctctgtt
gaaaatctctgcacaataatatggacatggagtccccctgaaggagccagtccaaattgc
agtctcagatatttcagtcactttgatgaccaacaggataagaaaattgctccagaaact
catcgtaaagaggaattacccctagatgagaaaatctgtctgcaagtggggtcccagtgt
agtgccaatgaaagcgagaagcctagccctttggtgaaaaagtgcatctcaccccctgaa
ggtgatcctgagtctgctgtgactgagctcaagtgcatttggcataacctgagctatatg
aaatgttcctggctccctggaaggaatacaagccctgacacaaactatactctttactat
tggtacagcagcctggagaaaagtcttcaatgtgaaaacatctatagagaaggtcaacac
attgcttgttcctttaaattgactaaagtgaaacctagttttgaacatcataacgttcaa
ataatggtcaaggataatgctgggaaaattagaccatcctgcaaaatagtgtctttaact
tcctatgtgaaacctgatcctccacatattaaacatcttctcctcaaaaatggtgcctta
ttagtgcagtggaagaatccacagaattttagaagcagatgcttaacttatgaagtggaa
gtcaataatactcaaactgaccgacataatattttagaggttgaagaggacaaatgccag
aattccgaatctgatagaaacacggagggtgcaagttgtttcctattccctggtgttctt
gccgacactgtctacacagtcagagtaagagtcaaaacaaacaagttatgctttgatgac
aacaaactgtggagtgattggagtgaagcacagagtataggtaaggagcgaaactccacc
ttctacaccaccatgttactcatcattccagtctttgtcgcagtggcagtcataatcctc
cttttttacctgaaaaggcttaagatcattatatttcctccaattcctgatcctggcaag
atttttaaagaaatgtttggagaccagaatgatgataccctgcactggaagaagtatgac
atctatgagaaacaatccaaagaagaaacggattctgtagtgctgatagaaaacctgaag
aaagccgctccttga

KEGG   Mus pahari (shrew mouse): 110313918
Entry
110313918         CDS       T05929                                 

Gene name
Il2rg
Definition
(RefSeq) cytokine receptor common subunit gamma isoform X1
  KO
K05070  interleukin 2 receptor gamma
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04061  Viral protein interaction with cytokine and cytokine receptor
mpah04144  Endocytosis
mpah04151  PI3K-Akt signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah05162  Measles
mpah05166  Human T-cell leukemia virus 1 infection
mpah05200  Pathways in cancer
mpah05321  Inflammatory bowel disease
mpah05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110313918 (Il2rg)
   04151 PI3K-Akt signaling pathway
    110313918 (Il2rg)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110313918 (Il2rg)
   04061 Viral protein interaction with cytokine and cytokine receptor
    110313918 (Il2rg)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110313918 (Il2rg)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    110313918 (Il2rg)
   04659 Th17 cell differentiation
    110313918 (Il2rg)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110313918 (Il2rg)
  09163 Immune disease
   05321 Inflammatory bowel disease
    110313918 (Il2rg)
   05340 Primary immunodeficiency
    110313918 (Il2rg)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110313918 (Il2rg)
   05162 Measles
    110313918 (Il2rg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110313918 (Il2rg)
   04090 CD molecules [BR:mpah04090]
    110313918 (Il2rg)
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  IL2 receptor family
   110313918 (Il2rg)
CD molecules [BR:mpah04090]
 Proteins
  110313918 (Il2rg)
SSDB
Motif
Pfam: IL6Ra-bind fn3 EpoR_lig-bind IL4Ra_N Interfer-bind IL2RB_N1
Other DBs
NCBI-GeneID: 110313918
NCBI-ProteinID: XP_021044044
Ensembl: MGP_PahariEiJ_G0031821
LinkDB
Position
X
AA seq 369 aa
MLKQLLSPRSFLLLQLLLLRAGWSSKVLMSSGNEDTKADSILTSTAPEHLSAPTLPLPEV
QCFVFNIEYMNCTWNSSSEPQATNLTLHYRYKVSDNNTFQECSHYLFSKEITSGCQIQKE
DIQLYQTFVVQLQDPQKPQRRAVQKLNLQNLVIPRAPENLTLRNLSESQLELRWRSRHII
ERCLQYLVQYRSNRDRSWTELIVNHEPRFSLPSVDELKLYTFRVRSRYNPICGSSQQWSE
WSQAVHWGSHTVEEDPSLFALEAVLIPVGTMGLIITLIFVYCWLERMPQIPPIKNLEDLV
TEYQGNFSAWSGVSKGLTESLQPDYSERFCHVSEILPKGGALGEGPGGSPCSLHSPYWPP
PCYSLKPEA
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgttgaaacaattattgtcacctagatccttcttactccttcagctgcttctgctgagg
gcagggtggagctccaaggtcctcatgtccagtgggaatgaagacaccaaagctgattcg
atcctgacttctacagcccctgaacacctcagtgctcctactctgccccttccagaggtt
caatgctttgtgttcaacatagagtacatgaattgcacttggaatagcagttctgagcct
caagcaaccaacctcacgctgcattacaggtacaaggtatctgataataatacattccag
gagtgcagccattatctgttctccaaagagattacttctggctgtcagatacaaaaagaa
gatatccagctctaccagacatttgttgtccagctccaggacccccagaaaccccagagg
cgagctgtacagaagctaaacctacagaatcttgtgatcccacgggctccagagaatcta
acacttcgcaatctgagtgaatcccagctagagctgagatggagaagcagacatattata
gaacgctgtttacaatacttggtgcagtaccggagcaaccgagatcgaagctggacggaa
ctaatagtgaatcatgaacctagattctccctgcctagtgtggatgagctgaaactgtac
acattccgggttcggagccgctataacccaatctgtggaagttctcaacagtggagtgaa
tggagccaggcagtccactgggggagccatactgtagaggaggatccttccttgtttgca
ctggaagctgtgcttatccctgttggcaccatggggttgattattaccctgatctttgtg
tactgttggttggaacgaatgcctcaaattccccccatcaagaatctagaggatctggtt
actgaataccaagggaacttttcggcctggagtggtgtgtctaaagggctgactgagagt
ctgcaaccagactacagtgaacggttctgccacgtcagcgagattctccccaaaggaggg
gccctaggagaggggcctggaggttctccttgcagcctgcatagcccttactggcctccc
ccatgttattctctgaagcctgaagcctga

KEGG   Mus pahari (shrew mouse): 110314118
Entry
110314118         CDS       T05929                                 

Gene name
Il13ra2
Definition
(RefSeq) interleukin-13 receptor subunit alpha-2 isoform X1
  KO
K05077  interleukin 13 receptor alpha-2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110314118 (Il13ra2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110314118 (Il13ra2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110314118 (Il13ra2)
   04090 CD molecules [BR:mpah04090]
    110314118 (Il13ra2)
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  IL3 receptor family
   110314118 (Il13ra2)
CD molecules [BR:mpah04090]
 Proteins
  110314118 (Il13ra2)
SSDB
Motif
Pfam: IL6Ra-bind EpoR_lig-bind LIFR_N
Other DBs
NCBI-GeneID: 110314118
NCBI-ProteinID: XP_021044238
Ensembl: MGP_PahariEiJ_G0032020
LinkDB
Position
X
AA seq 383 aa
MAFVDPRCLCFILLCTITGYSLEMKVNPPQDFEILDPGLLGYLYLQWKPPMVMEKFKGCT
LEYELKYRNVDSYSWKTIITRNLIYKDGFDLNKGIEGKIRTHLSEHCTNGSEVLSPWTEA
SYGISDEGSLETKIQDMKCIYYNWQYLVCSWKPGKTAHSDTNYTMFFWYEGLDHALQCAD
YLQDNEKNVGCKLSNLDSSDYKDFFICVNGSSKLEPIRSSYTVFQLQNIVKPLPPEFLHI
SVENSIDIRMKWSTPGGPIPPRCYTYEIVIREDDISRESATDKNDMKLKRRANESEDLCF
FVRCKVNIYCADDGIWSEWSEEECWEGYTRPDSKIIFIVPVCLFFIFLLLLLCLIMEKEE
PEPTLSLHVDLNKEVCAYEDTLC
NT seq 1152 nt   +upstreamnt  +downstreamnt
atggcttttgtggatcccagatgcttgtgtttcattcttctttgtacaataactggctat
tctttggagatgaaagttaatccccctcaggattttgaaatattggatcctgggttactt
ggttatctctatttgcaatggaaacctcccatggttatggaaaaatttaagggctgcaca
ctagaatatgagttaaaataccgaaatgttgatagctacagctggaagactataattact
aggaatctaatttacaaggatgggtttgatcttaataaaggcattgaaggaaagatacgt
acgcatttgtcagagcattgtacaaatggatcagaagtactaagtccatggacagaagct
tcttatgggatatcagatgaaggaagtttggaaactaaaattcaggacatgaagtgcata
tattataactggcagtatttggtctgctcttggaaacctggtaagacagcacattctgat
accaactataccatgtttttctggtatgagggcttggatcatgccttacagtgtgctgat
tacctccaggataatgaaaaaaatgttggatgcaaactgtccaacttggactcatcagac
tataaagatttttttatctgtgttaatggatcttcaaagttggaacccatcagatccagc
tataccgtttttcaacttcaaaatatagttaaaccattgccaccagaattccttcatatt
agtgtggagaattccattgacattagaatgaaatggagcacacctggaggacccattcca
ccaaggtgttacacttatgaaattgtgatccgagaagacgacatttcccgggagtctgcc
acagacaaaaacgatatgaagttgaagaggagagcaaatgaaagtgaagacctatgcttt
tttgtaagatgtaaggtcaatatatattgtgcagatgatggaatttggagcgaatggagt
gaagaggaatgttgggaaggttacacaaggccagactcaaagattattttcatagtacca
gtttgtcttttctttatattccttttgttacttctttgccttattatggagaaggaggaa
cctgaacccacattgagcctccatgtggatctgaacaaagaagtgtgtgcttacgaagat
accctctgttaa

KEGG   Mus pahari (shrew mouse): 110315436
Entry
110315436         CDS       T05929                                 

Definition
(RefSeq) granulocyte-macrophage colony-stimulating factor receptor subunit alpha
  KO
K05066  granulocyte-macrophage colony-stimulating factor receptor alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04630  JAK-STAT signaling pathway
mpah04640  Hematopoietic cell lineage
mpah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110315436
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110315436
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110315436
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110315436
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110315436
   04090 CD molecules [BR:mpah04090]
    110315436
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  IL3 receptor family
   110315436
CD molecules [BR:mpah04090]
 Proteins
  110315436
SSDB
Motif
Pfam: IL6Ra-bind IL3Ra_N Ribosomal_S14 fn3
Other DBs
NCBI-GeneID: 110315436
NCBI-ProteinID: XP_021045150
LinkDB
Position
Unknown
AA seq 389 aa
MTSSHAMRINPLPQLALLFTLLFPGTQALLAPTTQDASSALNLTFDPWTRMLTWACDATA
GNVTVTSCTVTAREAGILRRVQPQGCRCWFRKMMALHRGVTLDVNGTVGGAPAHWRLSFV
NAGAAGSGAENLTCEIRAARFLSCAWRAGPAAPADVRYSLRVLNSTGHDVARCFAHPDPG
DGVITRCIADDLSLLGSEAYLVVTGRSHAGPVRFLDAVEDTKALERLGPPRDVTASCNSS
HCAVTWAPPTTWAPLTARDFQFEVEWQSAEPGSTPRKVLVVEETRLAFPSPTPRGGHGVR
VRAGDTRLKHWGEWSPAHLLEAEDARVPSAVVFAVTACAVLLCALALGVTCIRFEVTRRL
FPPIPGIRDKVSDNVRVNPETLRKDLLQP
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgacgtcatcacacgccatgagaatcaaccccctgcctcagctggccctgctcttcacg
ttactgtttccggggacccaggcccttctggctccgaccacacaggacgccagctccgcc
ctcaacctgaccttcgacccctggacccggatgctgacctgggcctgcgacgccaccgcg
ggaaacgtcacggtgacgtcatgcaccgtgaccgcgcgggaggcggggatactgcggcga
gtccagccccagggttgccgctgctggttcaggaagatgatggctttgcaccgcggtgtc
acgctggatgtcaacggcacggtcggaggcgcgcctgcgcactggaggctgagcttcgtc
aacgcaggcgcggcgggctcgggggcggagaacctgacctgcgagatccgcgcagcgcgc
ttcctgtcctgcgcgtggcgggcggggccagcggcacccgcggacgtccggtactcgctg
cgcgtcctcaactccacgggtcatgacgtcgcgcgatgcttcgcccaccccgaccctggc
gatggcgtcatcacacggtgcattgcggacgacttgtcgctgttggggagcgaggcctac
ctggtcgtgaccggtcggagccatgcggggccagtgcggttcctggacgcagtggaggac
acaaaggcgctcgagcggctcggtcccccacgtgacgtcaccgcgtcctgtaactcctcc
cactgtgccgtcacgtgggccccgcccacgacctgggcgcccttgacagccagggacttc
cagtttgaggtcgagtggcagagcgccgagccaggaagcacgccccggaaggtgcttgtt
gtggaggagacccgcctcgccttccccagccccaccccccgcggaggtcacggggtcagg
gtgcgcgcgggcgacacccggttgaagcactggggcgaatggagccccgcccatctgctc
gaggctgaggacgcgcgggtgcccagcgcggtcgtgtttgcagtgaccgcctgcgcggtc
ctactgtgcgcgctggcgctcggggtgacgtgcataaggttcgaagtgacgcgccgactc
ttcccgcccatccccgggatcagggacaaggtgtccgacaatgtgcgagtgaaccctgag
accctcaggaaggacctcttgcagccctag

KEGG   Mus pahari (shrew mouse): 110316620
Entry
110316620         CDS       T05929                                 

Gene name
Il12rb2
Definition
(RefSeq) interleukin-12 receptor subunit beta-2 isoform X1
  KO
K05064  interleukin 12 receptor beta-2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04630  JAK-STAT signaling pathway
mpah04658  Th1 and Th2 cell differentiation
mpah05200  Pathways in cancer
mpah05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110316620 (Il12rb2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110316620 (Il12rb2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    110316620 (Il12rb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110316620 (Il12rb2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    110316620 (Il12rb2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110316620 (Il12rb2)
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  IL6/12 receptor family
   110316620 (Il12rb2)
SSDB
Motif
Pfam: fn3 Lep_receptor_Ig Pur_ac_phosph_N IL6Ra-bind ig DUF1035 ObR_Ig
Other DBs
NCBI-GeneID: 110316620
NCBI-ProteinID: XP_021046690
Ensembl: MGP_PahariEiJ_G0022209
LinkDB
Position
2
AA seq 873 aa
MAHTIRECSLALLFLFMWLLIKANIDVCKLGAVTVQPAPVIPLGSAANISCSLNPKQGCS
HHPSSNELILLKFVNDVLVENLHGKKVHDHTGHSSTFQVTNLSLGMTLFVCKLNCSSSQK
TLPVPVCGVEISVGVVPEPPQNISCVQEGENGTVACSWNSGKVTYLKTYYTLQLSGPNNL
TCQNQCYSDNRHNCNRLDLGINLTPDLAESRFTVRVTAINDLGNSSSLPHTFTFLDIVSP
LPPWNIRINFLNASGSRCTLQWEDEGQVVLNRLRYQPLNSTSWNTVNATNAKGRHDLQDL
RPFTEYEFQISSKLHLSEGSWSNWSESLRTRTPEEEPVGILDIWYTKQDIDYDRQQISLF
WKSLNPSEARGKILHYQVTLQEVTKKTTLQNTTRHNSWTMVIPRTGAWTASVSAANSKGT
SAPTYINIVDLCGTGLLAPHEVSAKSETMDNIRVTWQPPRKAASAVREYIVEWRALQPGS
IVKFPPHWLRIPPYNMSALISENIKPYICYEIRVHALSESQGGCSSIWGDSRHKAPLSGP
HITAITEKKESLFISWTHIPFLEQRGCILHYRIYWKERDSTAQPELCEIQYRHSQNSHPI
SSLQPRVTYVLWMTAVTAAGESPQGNEREFCPQGKANWKTFVISSICIAVIIVGTFSIRY
FRQKAFTLLSTLKPQWYSRTIPDPANSTWVKKYPIMEEKIQLPTDNLLMAWPTPEEPEPL
IINEVLYQMIPVVRQPYYFKRGQGFQGYSTSKEDTIYIANPQTTGTLTAETRQLVNLYKV
LESRDPDSKLGNLTSPLTVTPVNYLPSHEGYLPSNIEVLPHEADPTDSLDLEHQHISLSI
FASSSLPPLIFSGERLTLDRLKMGYDSLMNNEA
NT seq 2622 nt   +upstreamnt  +downstreamnt
atggcacacaccattagagaatgctcattggcacttctttttttgttcatgtggctgttg
attaaagcaaatatagatgtgtgcaagcttggtgctgtgactgtccagcctgcccctgtg
attcctcttgggtcagctgccaatatttcctgctccttgaatcccaaacaaggctgttca
catcatcccagttctaatgaattaatcctcttaaagtttgtcaatgatgtccttgttgaa
aatctccatggcaaaaaagtccatgaccacactggtcactcctccacttttcaagtcacc
aacctgtcccttggtatgaccttgtttgtctgcaagctaaactgtagcagctctcaaaag
acgctaccagtcccagtatgtggggttgagatctcagttggtgttgttccagagccacct
caaaacatatcatgtgtccaagaaggagaaaatggaactgtggcctgctcctggaactct
ggaaaagttacttatctgaaaacctattacactttacagttaagcggaccaaacaatctg
acctgtcagaaccaatgttattctgacaatcgtcataactgtaatcgactggatcttggg
atcaatctaacccctgatttagctgaatccaggttcacagtccgtgttactgccatcaat
gatcttggaaattcttcttcacttccgcatacgttcacgttcttggacatagtgagccct
cttccgccgtggaacatcagaatcaactttctaaatgcttctgggagcagatgtacactg
cagtgggaagatgaggggcaagtggtactcaatcgactcagataccagcctcttaacagc
acatcctggaacacggttaatgctacaaatgccaaaggaagacatgaccttcaagatctg
agaccatttacagaatatgaatttcaaatctcctctaagctacatctctctgaaggaagt
tggagtaattggagtgagtcactgagaacacgaacaccagaggaagagcctgttgggata
ttagacatctggtacacgaaacaagacatcgactatgacagacagcagatttctcttttc
tggaagagtctgaatccatcagaagcaagggggaagatcctccactatcaggtgacctta
caagaggtgacaaagaaaacaacactgcagaatactacaagacacaactcctggaccatg
gtcatccctagaactggggcttggactgcatctgtgtctgcagccaactcgaaaggcact
tctgcacccacttacattaacatagtggacctgtgtggcacggggctgctggctcctcac
gaggtctctgcaaagtcagagaccatggacaacattcgggtgacctggcagcctcccagg
aaagctgcttctgctgttcgggagtacatagtggaatggagagctctccaaccagggagc
atcgtgaagtttcccccacactggctgcggatccccccgtacaacatgtctgctctgatt
tcagagaacataaagccctatatctgttatgaaatcagggtgcatgcactgtcagagagc
caaggagggtgcagctccatctggggtgactccaggcacaaagcaccactgagtggccct
cacatcactgccatcacagagaaaaaggaaagcctttttatttcctggacccacattcca
ttcctggagcaaagaggctgcatcctccattacagaatatactggaaagaacgagactcg
acagcacaacctgaactctgcgaaattcagtacagacactctcaaaactcacatccaata
agcagcctacagcccagggtgacatatgtcctatggatgacagctgtgacagctgctggt
gaaagtccccaaggaaatgaaagggaattttgtccacagggcaaagccaattggaaaaca
ttcgtgatatcaagcatttgcattgctgtcatcatagtgggcacgttctcaattcgttac
ttccggcaaaaggcatttactctcctttctaccctcaaacctcaatggtatagcagaacc
attccagatccagcaaatagcacttgggtaaagaagtatcccattatggaggagaagatc
cagctacctacggataacttactgatggcctggcccactcctgaagagcctgagcccctg
atcatcaatgaagtcctctaccaaatgatcccagttgtcagacaaccttattactttaaa
agaggacaaggattccaaggttactctacctccaaggaagacacaatatatattgccaat
ccacaaactacaggaactctgacagctgagacgagacaattagtgaacctatacaaggtg
ctagaaagcagggaccctgactcaaaactgggcaacctgaccagccccttgacagtcacc
ccagtgaactaccttcctagccatgaaggctatttaccttccaacatagaagttttacca
catgaggctgatccaactgattctttagacctggagcatcaacatatttctctttccatt
tttgcatcaagttctctccccccactcatcttcagtggtgagaggctgactctagatcgg
ttaaagatgggctatgactccctcatgaataatgaggcttga

KEGG   Mus pahari (shrew mouse): 110316831
Entry
110316831         CDS       T05929                                 

Gene name
Il23r
Definition
(RefSeq) interleukin-23 receptor
  KO
K05065  interleukin 23 receptor
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04630  JAK-STAT signaling pathway
mpah04659  Th17 cell differentiation
mpah05200  Pathways in cancer
mpah05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110316831 (Il23r)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110316831 (Il23r)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    110316831 (Il23r)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110316831 (Il23r)
  09163 Immune disease
   05321 Inflammatory bowel disease
    110316831 (Il23r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110316831 (Il23r)
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  IL6/12 receptor family
   110316831 (Il23r)
SSDB
Motif
Pfam: IL6Ra-bind fn3 IL2RB_N1 IL12p40_C ObR_Ig
Other DBs
NCBI-GeneID: 110316831
NCBI-ProteinID: XP_021046881
Ensembl: MGP_PahariEiJ_G0022210
LinkDB
Position
2
AA seq 639 aa
MRREREMRGFYYIWDMSHLTLQLHVVITLYVLFRWCQGGITSINCSGNMWVEPGEIFQMG
MNVSIYCQEALKHCRPRNLYFYKNGFKEEFDITRINRTTARIWYKGFSEPHAYMHCTAEC
PGHFQETLICGKDISSGHPPDAPSNLTCVIYEYSGNMTCTWNTGKPTYIDTKYIVHVKSL
ETEEEQQYLASSYVNISTDSLQGSRKYLVWVQAVNTLGMENSQQLQVHLDDIVIPSASII
SRAETTNATVPKTIIYWKSKTMIEKVFCEMRYKATTNQTWSVKEFDANFTYVQQSEFYLE
ANRKYVFQVRCQETGKRNWQPWSSPFVHQTSQTVSQVTAKSSHEPQEIEMLTATIFRGHP
ASDNRQDIGLLSGMVFLAIMLPMFSLIGIFNRSLRIGIKRKVLLMIPKWLYEDIPNMENS
SVAKLLQEKGVFENDNASEQALYVDPVLTEISEISPLEHKPTDYKEERLTGLLETRDCPL
TTLSTSSSVVYIPDLNTGYKPQVSNVPPGGNHFINRDERDPTSLEATDDHFARLKMYPNF
QFSASSMALLSKTLILDELSLVLNQGEFNSLDIQNSRQEETSMILQSDSPSETIPAQTLL
SDEFVSCLAIRHEDLPSSNSYFPQNVLESHFSRISLLQK
NT seq 1920 nt   +upstreamnt  +downstreamnt
atgagaagagagagagaaatgagaggtttctactacatttgggacatgagtcacctcaca
cttcagttgcatgtggtaataaccctttatgtgctcttcagatggtgtcaaggaggaatc
acaagcataaactgctctggtaacatgtgggttgagcctggtgaaatttttcagatgggt
atgaatgtttctatatattgccaagaagcccttaagcactgccgaccaaggaatctttac
ttttataaaaatggcttcaaagaagaatttgatatcacaaggattaatagaaccacagct
cggatttggtataaaggcttttcggaacctcatgcctatatgcattgcactgctgaatgt
cctggtcattttcaagagacacttatttgtgggaaagacatttcttctggacatccacca
gatgcccccagcaatctgacatgtgtcatttatgaatactcaggcaacatgacttgcacc
tggaacactgggaagcccacctacatagataccaagtatattgtgcatgtgaagagtttg
gagacagaagaagaacaacaatatcttgcctcaagctatgttaacatctccactgactca
ttgcaaggcagcaggaagtatttggtatgggtccaagctgtcaataccctaggcatggag
aactcacaacaactacaagtccatctggatgatatagtgataccttctgcatccatcatt
tccagggctgagactacaaacgctactgtacccaagaccataatttactggaaaagcaag
actatgattgagaaagtattctgtgagatgagatacaaagcaacaacaaaccaaacgtgg
agtgttaaagaatttgatgccaatttcacatatgtgcagcagtcagaattctacctggag
gcaaacaggaagtatgtatttcaagtgcgatgtcaagaaactggtaagagaaactggcag
ccttggagttcgccctttgtccatcaaacttcccagacagtttcccaggttacagcaaaa
tcatcccatgaacctcaggagattgagatgctcactgctacaatcttcagaggacatcct
gcttcagataatcgtcaagacattggacttttgtcaggaatggtcttcttggccatcatg
ttgccgatgttttccctgattggaatatttaacagatcacttcgaataggaattaaaaga
aaagtcttactgatgatcccaaaatggctttatgaagatattcctaatatggaaaatagc
agtgttgcaaaattattacaggaaaaaggtgtatttgagaatgataatgccagtgagcag
gccctgtatgtggatcctgtccttacagagataagtgaaatctctcccctggaacacaaa
cccacagattacaaagaagaaaggctcacaggacttcttgagacaagagactgtcctcta
actacactgtctaccagttcttctgttgtgtatattcctgatctcaacactggatacaaa
ccccaggtttcaaatgttcctcctggaggaaaccatttcattaacagagatgaaagagac
cctacatcccttgaggccacagatgaccactttgccagattgaaaatgtatcccaacttc
caattttctgcttcaagtatggctttactaagcaaaacactaattcttgatgaattgagc
cttgttttaaatcaaggagaattcaattctcttgacatacaaaactcaagacaggaggaa
accagcatgattttgcaaagtgactcacccagtgaaactatcccagcgcagactctgctg
tctgatgaatttgtctcctgtttggcaatcagacatgaagacttgccgtctagtaattct
tactttccacagaacgttttggaaagccatttcagtaggatttcactcttgcaaaagtag

KEGG   Mus pahari (shrew mouse): 110317305
Entry
110317305         CDS       T05929                                 

Gene name
Il5ra
Definition
(RefSeq) interleukin-5 receptor subunit alpha isoform X1
  KO
K05067  interleukin 5 receptor alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04630  JAK-STAT signaling pathway
mpah04640  Hematopoietic cell lineage
mpah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110317305 (Il5ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110317305 (Il5ra)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110317305 (Il5ra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110317305 (Il5ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110317305 (Il5ra)
   04090 CD molecules [BR:mpah04090]
    110317305 (Il5ra)
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  IL3 receptor family
   110317305 (Il5ra)
CD molecules [BR:mpah04090]
 Proteins
  110317305 (Il5ra)
SSDB
Motif
Pfam: IL6Ra-bind fn3 Tissue_fac EpoR_lig-bind
Other DBs
NCBI-GeneID: 110317305
NCBI-ProteinID: XP_021047393
Ensembl: MGP_PahariEiJ_G0022448
LinkDB
Position
2
AA seq 415 aa
MVPVLLILVGALATLQADLLSHKKFLLLPPVNFTIKATGLAQVLLHWDPNPDQEKRHVDL
EYHVKINAPQEDEYDTSKTESKCVTPLHEGFAASVRTILKSSHTALASSWVSAELKAPPG
SPGTSVTNLTCTTHTVVSSHTHLRPYQVSLHCTWLVGKDAPEDTQYFLYYRFDVWTEGCQ
EYSRDALNRNTACWFPRTSINSKRLEQLAVHINGSSKHAVIKPFDQLFTPYAIDRVNPPM
NVTVEMESNSLYIHWEKPLSAFPGHCFNYELKIYNTKNGHVQKENLITNKFISKIDGVST
YSIQVRAAVSLPCRMPGRWGEWSQPIYVGKERKPLVEWRLFVLPTAACFVLLTFSVICRV
CHLWTRLFPPVPAPKSNIKDLPVVTEYEKPSNESKIEVVHCVEEVGFEVMENSTF
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggtgcctgtgttactaattctcgtgggagctttggcaacactgcaagctgacttactt
tctcacaaaaagtttttacttctacctcctgtcaattttaccattaaagccactggatta
gctcaagttcttttacactgggacccaaatcctgaccaagagaaaaggcatgttgatctg
gagtatcatgtgaaaataaatgccccacaagaagatgagtatgataccagcaagactgaa
agcaaatgtgtgaccccccttcatgaaggctttgcagctagtgtgaggaccatcctgaag
agcagccatacagctctggccagcagttgggtttctgctgaactcaaagctccaccagga
tctcctggaacctcggttacgaatttaacctgtaccacacacactgtcgtaagtagccac
acccacttaaggccataccaagtgtctcttcattgcacctggcttgttggcaaggatgcc
cccgaggacacacagtatttcctatactacaggtttgatgtttggactgaaggatgccaa
gaatacagcagagatgcactgaacagaaatactgcatgctggtttcccaggacatcaatc
aacagcaaaaggcttgagcagcttgctgtgcacattaatggctcaagcaagcatgctgta
atcaagccctttgatcagctgttcactccatacgccattgaccgagtgaatcctccaatg
aacgtcacagtggaaatggaaagcaattctctctatatacattgggagaaaccactttct
gcctttccaggccattgctttaactatgagttgaaaatttacaacacaaaaaatggtcat
gttcagaaggaaaacctgatcaccaataagttcatctcaaaaattgatggcgtttctaca
tattccattcaagtgagagcagctgtgagcttaccttgcagaatgccaggaaggtggggc
gagtggagtcaacctatttatgtgggaaaggaaaggaagcccttggtagaatggcgtctc
ttcgtgctcccgacagccgcctgctttgtcttgttaactttctcagtcatctgcagagtg
tgtcatctatggaccaggttgtttccaccggttcctgccccgaagagtaatatcaaagat
ctccctgtggtgactgaatatgagaaaccttcgaatgaaagtaaaattgaagttgtacat
tgtgtggaagaggttggatttgaagtcatggaaaattccacattttga

KEGG   Mus pahari (shrew mouse): 110320682
Entry
110320682         CDS       T05929                                 

Gene name
Il6r
Definition
(RefSeq) interleukin-6 receptor subunit alpha isoform X1
  KO
K05055  interleukin 6 receptor
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah04060  Cytokine-cytokine receptor interaction
mpah04061  Viral protein interaction with cytokine and cytokine receptor
mpah04066  HIF-1 signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04640  Hematopoietic cell lineage
mpah04659  Th17 cell differentiation
mpah04932  Non-alcoholic fatty liver disease
mpah05163  Human cytomegalovirus infection
mpah05171  Coronavirus disease - COVID-19
mpah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110320682 (Il6r)
   04066 HIF-1 signaling pathway
    110320682 (Il6r)
   04151 PI3K-Akt signaling pathway
    110320682 (Il6r)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110320682 (Il6r)
   04061 Viral protein interaction with cytokine and cytokine receptor
    110320682 (Il6r)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110320682 (Il6r)
   04659 Th17 cell differentiation
    110320682 (Il6r)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110320682 (Il6r)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110320682 (Il6r)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    110320682 (Il6r)
   05163 Human cytomegalovirus infection
    110320682 (Il6r)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110320682 (Il6r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110320682 (Il6r)
   04090 CD molecules [BR:mpah04090]
    110320682 (Il6r)
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  IL6/12 receptor family
   110320682 (Il6r)
CD molecules [BR:mpah04090]
 Proteins
  110320682 (Il6r)
SSDB
Motif
Pfam: IL6Ra-bind ig Ig_3 fn3 Ig_6 I-set Ig_5
Other DBs
NCBI-GeneID: 110320682
NCBI-ProteinID: XP_021052458
Ensembl: MGP_PahariEiJ_G0026663
LinkDB
Position
4
AA seq 460 aa
MLAVGCTLLVALLAAPAVALVLGSCRALEVSNGTVTSLPGATVTLVCPGKEAAGNVTIHW
AYSGSQNRKWTTTGNTLVLRAVQLSDTGDYLCFLGDHLVGSVPLLVDVPPEEPKLSCFRK
NPLVNAVCEWRPSSTPSPTTKAVLFAKKINTTNGKSDFQVPCQYSQQLKSFSCQVEILEG
DKVYHIVSLCVANSVGSKSSHNVDFHSLKMVQPDPPANLVVSAIPGRPRWLKVSWQHPES
WDPSYYLLQFQLRYRPVWSKVFTVWLLPVAQYQCVIHDALRGVKHVIQVRGKEELDLGQW
SEWSPEVTGTPWIAEPRTTPAGILWNPTQVSVEDDDNHEDQYGSSTEATSVLAPVQESSS
MSLPTFLVAGGSLAFGLLLCVFIILRLKQKWKSQAEKESKTASAPPPPYSLGPLKATFLL
VPLLTPHSSGSDNTVSHSCLGVRDAPSPYDSSNRDYLLPR
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgctggccgtcggctgcacgctgctggtcgccctgctggccgcgcccgcggtcgcgctg
gtcctcgggagctgccgcgcgctggaggtgtcaaatggcacggtgacaagcctgccaggg
gccacggttaccctggtttgtcccgggaaggaagcagcaggcaacgttaccattcactgg
gcatactctggctcacagaacagaaaatggactaccacgggaaacacactggttctgagg
gccgtgcagctcagcgacactggggactatttgtgcttcctgggtgatcacctagtgggg
tctgtgcccttgctggtggatgttcccccagaggagcccaagctctcctgcttccggaag
aacccccttgtcaacgctgtctgtgagtggcgaccgagcagcaccccctctccaaccacg
aaggctgtgctgtttgcaaagaaaatcaacaccaccaacgggaagagtgacttccaggtg
ccctgccagtattctcagcagctgaaaagcttctcctgccaggtggagatcctggagggt
gacaaagtgtaccacatagtgtcactgtgcgttgcaaacagtgtcggaagcaagtccagc
cacaatgtagatttccacagcttaaaaatggtgcagccagatccacctgccaaccttgtg
gtatcagccataccaggaaggcctcgctggctcaaagtcagttggcagcaccctgagtcc
tgggacccgagttactacttgctgcagttccagcttcgataccgacctgtatggtcaaag
gtgttcacggtgtggctgctcccggtggcccagtaccaatgcgtcatccatgatgccttg
cgaggagtgaagcacgtgatccaggtccgtgggaaggaggagcttgaccttggccagtgg
agcgaatggtccccagaggtcacgggcactccttggatagcagagcccaggaccactccg
gcagggatcctctggaaccccacacaggtctctgttgaagacgatgacaaccatgaggat
cagtacggaagttctacagaagcgacgagtgtcctcgccccagtgcaagaatcctcgtcc
atgtccctgcccacattcctggtagctggaggaagcctggcatttgggttgctcctctgt
gtcttcatcatcctaagactcaagcagaaatggaagtcgcaggctgagaaggaaagcaag
acggcctctgccccacccccaccgtattccttgggcccgctgaaggcgacctttcttctg
gttcctctcctcaccccacacagctctgggtctgacaacaccgtaagccacagttgcctg
ggtgtcagggacgcaccgagcccttatgacagcagcaacagagactacttactccccaga
taa

KEGG   Mus pahari (shrew mouse): 110322802
Entry
110322802         CDS       T05929                                 

Gene name
Lepr
Definition
(RefSeq) leptin receptor isoform X1
  KO
K05062  leptin receptor
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04080  Neuroactive ligand-receptor interaction
mpah04152  AMPK signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04920  Adipocytokine signaling pathway
mpah04932  Non-alcoholic fatty liver disease
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110322802 (Lepr)
   04152 AMPK signaling pathway
    110322802 (Lepr)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110322802 (Lepr)
   04060 Cytokine-cytokine receptor interaction
    110322802 (Lepr)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110322802 (Lepr)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110322802 (Lepr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110322802 (Lepr)
   04090 CD molecules [BR:mpah04090]
    110322802 (Lepr)
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  Prolactin receptor family
   110322802 (Lepr)
CD molecules [BR:mpah04090]
 Proteins
  110322802 (Lepr)
SSDB
Motif
Pfam: ObR_Ig Lep_receptor_Ig fn3
Other DBs
NCBI-GeneID: 110322802
NCBI-ProteinID: XP_021055241
Ensembl: MGP_PahariEiJ_G0028544
LinkDB
Position
6
AA seq 1162 aa
MLCQRFYVVLLHWEFLYVIAALNLAYPISPWKFKLFCAPPNTADNSFLSPAGVPDNASVL
KGASEAVVEARFNSSGIYISELSKTVFHCCFGNEQGQNCSTLTDSTEGKTLASVVKTSVF
RQLGVNWDVECWMKGDLTLFICHMEPLPKNPFKNYDSKVHLLYDLPEVIDDSPLPPLKDS
FQTVQCNCSLWECECHVPVPRAKLNYALLMYLEITSAGVSFQSPLMSLQPMLVVKPDPPL
GLHMEVTDDGNLKISWDSPTMAPFPLQYQVKYLENSTIVREAAEMLSATSLLVDSVLPGS
SYEVQVRSKRLDGSGVWSDWSSPQVFTTQDVVYFPPKILTSVGSNASFHCIYKNENQIIP
SKQIVWWRNLAEKIPEIQYSIVSDRVSKVTFSNLKATRPRGKFTYDAVYCCNEQACHHRY
AELYVIDVNINISCETDGYLTKMTCRWSPSTTQSLAGSTVQLRYHRRSLYCPDSPSIHPT
SEPKDCVLQRDGFYECIFQPIFLLSGYTMWIRINHSLGSLDSPPMCVLPDSVVKPLPPSN
VKAEITVNTGLLKVSWERPVFPENNLQFQIRYGLSGKEIQWKTHEVFDAKSKSASLLVSD
LCAVYVVQVRCRRLDGLGYWSNWSSPAYTLVMDVKVPMRGPEFWRKMDEDVTKKERNVTL
LWKPLTKNDSLCSVRRYVVKHRTAHNGTWSEDVGNQTNLTFLWTEPAHTVTVLAVNSIGA
SLVNFNLTFSWPMSKVSAVESLSAYPLSSSCVILSWTLSPDDYSLLYLVIEWKILNEDDG
VKWLRIPSNVKKFYIHDNFIPIEKYQFSLYPVFMEGVGKPKIINGFTKDVIDKQQNDAGL
YVIVPIIISSCVLLLGTLLISHQRMKKLFWDDVPNPKNCSWAQGLNFQKPETFEHLFTKH
AESVIFGPLLLEPEPISEEVSVDTAWKNKDEMVPATMVSLLLNTPDPESSSICISDQCNS
ANFSGAQSTQVTCEEECQRQPSVKYATLVSNDKLVETDEEQGFIHSPVSKCVSSKHSPLR
QSFSNSSWETEAQAFFLLSDQQPTMISPQLSFSGLDELLELEGSFPEENHGEKSICYLGV
TSVNRRENDVLLTGEAGILCTFPAQCLFSDIRILQERCSHFVENNLSLGTSGENFVPYMP
QFQTCSTHSHKIMENKMCDLTV
NT seq 3489 nt   +upstreamnt  +downstreamnt
atgttgtgtcagagattctacgtggttctgttacactgggaatttctttatgtgatagct
gcacttaacctggcatatccaatctctccctggaaatttaagttgttttgtgcaccaccg
aacacagccgataactcctttctctcacctgctggagtcccagacaatgcttcggttctg
aagggggcttctgaagcagttgttgaagctagatttaattcaagtggtatctacatttct
gagttatccaaaacagtcttccactgttgctttgggaatgagcaaggtcaaaactgctct
acactcacagacagcactgaagggaagacactggcttcagtggtgaagacttcagttttt
cgccagctaggtgtaaactgggacgtagagtgctggatgaaaggggacttgacattattc
atctgtcatatggaaccattacctaagaaccccttcaagaattatgactctaaggtccat
cttttatatgatctgcctgaagtcatagatgattcgcctctgcccccactgaaagacagc
tttcagactgtccagtgcaactgcagcctttgggaatgtgaatgtcatgtgccggtaccc
agagccaaactcaactatgctcttctgatgtatttggaaatcacatctgctggtgtgagt
tttcagtcacctctgatgtcactgcagcccatgcttgttgtgaaacccgatcccccacta
ggtttgcatatggaagtcacagatgatggtaatttaaagatttcttgggacagcccaaca
atggcaccatttccacttcaatatcaggtgaaatacttagagaattctacaattgtaaga
gaggctgctgaaatgctctcagctacatctctgctggtagacagcgtgcttcctggatct
tcatatgaggtccaagtgaggagcaagagactggatggctcaggagtctggagtgactgg
agttcacctcaagtctttaccacacaagatgttgtgtattttccacccaaaattctgact
agtgttggatcgaatgcttcctttcattgcatctacaaaaatgaaaaccagattatcccc
tcaaaacagatagtttggtggaggaatctagctgagaaaatccctgagatacagtacagc
attgtgagtgaccgtgttagcaaagttactttctccaatctgaaagccaccagacctcga
gggaagtttacctatgacgcagtgtactgctgcaatgagcaggcgtgccatcaccgctac
gctgaattatacgtgattgatgtcaatatcaatatatcatgtgaaactgacgggtactta
actaaaatgacttgcagatggtcacccagcacaacccaatcactagcgggaagcactgtg
cagttgaggtaccacaggcgcagcctgtattgtcctgatagtccatctattcatcctacg
tctgagcccaaagactgcgtcttacagagagacggcttttatgaatgtattttccagcca
atctttctattatctggctatacaatgtggatcaggatcaaccattctttaggttcactt
gactctccaccaatgtgtgtccttcctgactctgtagtaaaaccactacctccatctaat
gtaaaagcagagattactgtaaacactggattattgaaagtatcttgggaaaggccagtc
tttccagagaataaccttcaattccagattcgatatggcttaagtggaaaagaaatacaa
tggaagacacacgaggtattcgatgcaaaatcaaagtctgccagcctgctggtatcagac
ctctgtgcggtctatgtggtacaggttcgctgccggcggttggatgggctagggtattgg
agtaattggagcagtccagcctacacgcttgtaatggatgtaaaagttcctatgagaggg
cctgaattttggagaaaaatggatgaggacgtaactaaaaaggagagaaatgtcaccttg
ctttggaagcccctgacgaaaaatgactcactgtgtagtgtgaggaggtacgtggtgaag
catcgtactgcccacaatgggacatggtcagaagatgtgggaaatcagaccaatctcact
ttcctgtggacagaaccagcacacacggttacagttctggccgtcaattccatcggtgct
tcccttgtgaactttaaccttaccttctcatggcccatgagtaaagtgagtgctgtggag
tcactcagtgcttatcccctgagcagcagctgtgtcatcctctcctggacactgtcacca
gatgattatagtctgttatatctggttattgaatggaagatccttaatgaagatgatgga
gtgaaatggcttagaattccttcgaatgttaaaaaattttatatccacgataattttatt
cccattgagaaatatcaattcagtctttacccagtatttatggaaggagttggaaaacca
aagataattaatggttttaccaaagatgttatcgacaagcagcagaatgacgcagggctg
tatgtcattgtacccataattatttcctcttgtgtcctactgctcggaacactgttaatt
tcacaccagagaatgaaaaagttgttttgggatgatgttccaaaccccaagaattgttcc
tgggcacaaggacttaatttccaaaagcctgaaacatttgagcatctttttaccaagcat
gcagaatcagtgatatttggtcctcttcttctggagcctgaacccatttcagaagaagtc
agtgtcgataccgcttggaaaaataaagatgagatggtcccagcaactatggtctccctt
cttttgaacacaccagaccctgaaagcagttctatttgtattagtgaccagtgcaacagt
gctaacttctctggggctcagagcacccaggtaacctgtgaagaggagtgtcagagacaa
ccctcagttaaatatgcaactctggtcagcaacgataaattagtggaaactgatgaagaa
caaggttttatccatagtcctgtcagcaagtgcgtttccagtaaacattccccactgagg
cagtctttctctaacagctcctgggagacagaggcccaggcatttttccttttatcagat
cagcaaccaaccatgatttcgccacaactttcattctcagggttggatgagcttttggaa
ctggagggaagttttcctgaagaaaatcacggggagaagtctatctgttatctaggagtc
acctctgtcaacagaagagagaatgatgtgcttttgactggtgaggcaggaatactgtgc
acattcccagcccagtgtctattcagtgacatcaggatcctccaggagagatgctcacac
tttgtagaaaataatttgagtttagggacctctggtgagaactttgtaccttacatgccc
caatttcaaacctgttccacccacagtcacaagataatggagaataagatgtgtgactta
actgtgtaa

KEGG   Mus pahari (shrew mouse): 110322992
Entry
110322992         CDS       T05929                                 

Gene name
Il4r
Definition
(RefSeq) interleukin-4 receptor subunit alpha
  KO
K05071  interleukin 4 receptor
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04151  PI3K-Akt signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04640  Hematopoietic cell lineage
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah05200  Pathways in cancer
mpah05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110322992 (Il4r)
   04151 PI3K-Akt signaling pathway
    110322992 (Il4r)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110322992 (Il4r)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110322992 (Il4r)
   04658 Th1 and Th2 cell differentiation
    110322992 (Il4r)
   04659 Th17 cell differentiation
    110322992 (Il4r)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110322992 (Il4r)
  09163 Immune disease
   05321 Inflammatory bowel disease
    110322992 (Il4r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110322992 (Il4r)
   04090 CD molecules [BR:mpah04090]
    110322992 (Il4r)
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  IL2 receptor family
   110322992 (Il4r)
CD molecules [BR:mpah04090]
 Proteins
  110322992 (Il4r)
SSDB
Motif
Pfam: IL4Ra_N
Other DBs
NCBI-GeneID: 110322992
NCBI-ProteinID: XP_021055662
Ensembl: MGP_PahariEiJ_G0013644
LinkDB
Position
1
AA seq 809 aa
MGRLCTKFLTSVGCLILLLVTGSGSIKVLGEPTCFSDYIRTSTCEWHLDSTVNCSSQLHL
DYRLLLFEFAVNLTCIPRNSASTVCVCHMDTNAPVQTDEYQMELWAEHRQLWQGSFSPSG
NVRPPAPDNLTLHTNVSNEWLLTWNNPYPSNNLLYEDLIYMVNISREDNPAEFIVYNVTY
KEPRLSFPINILTSGLYYRARVRVKVQTFTGTWSEWSPDITWYNHFQPPLIQRLPLGVTI
SCLCILLFCLFCYFSITKIKKIWWDQIPTPARSPLVAIIIQDAQVPLWDKQTRSQESTKC
PRWKTCLAKLLPCLLEHRVKKKTEFPKAAPTKSLQSPGKAIWCPMEVSRTVLWPENVNVS
VVRCMELFEAPVQSVEEEEDETVKGDLSMSPENSGGGFQESQADIMARLTENLFSDLLEA
ENGGLGQSGLAESCSPLPSGSGQASVSWTCFPVGPSEEATGQVTEQPSHPGPLSGSPAQS
APTLACTQVPLVLADNPAYRSFSDCCSPAPDPGELAPEQQQATHLEEEVPRSLAVLRSSG
PPMQQVESWEQILHMSVLQHGAAAGSAPAPAGGYQDFVQAVKQGAVQEPGVPGAGPSGDP
GYKAFSSLLGSNGVRTDTAAAGTDSGHGGYKPFQNPVPNQSPSSVPLFTFGLDTELPPSP
LNSDPPQSTPECLGLELGLKGGDWLKAPPPADQVPKPFGDDLGFGIVYSSLTCHLCGHLK
QHHSPEEGGQSPVLASPGCGCCYDDRSPSLGSLSGALESCPEGMPPEANIMSAPKTPSNL
SGEGKGPGHSPVPSQTTEVPVGTLGIAVS
NT seq 2430 nt   +upstreamnt  +downstreamnt
atggggcggctttgcaccaagttcctgacctctgtgggctgtctgattttgctgttggtg
actggctctgggagcatcaaggtcctgggtgagcccacctgcttctctgactacatccgc
acttccacatgtgagtggcacctggatagcactgtgaactgcagttctcagctccacctg
gactacaggctgctgctcttcgagttcgctgtaaacctcacatgcatcccgaggaacagt
gccagcaccgtgtgtgtgtgccacatggacacaaatgcgcccgtccaaacagacgagtac
cagatggagctatgggctgagcacagacagctgtggcagggctccttcagtcccagtggt
aatgtgaggcccccagctccagacaacctcacactccacaccaatgtctccaacgaatgg
ctgctgacatggaataacccgtacccatcgaataacttactgtacgaagacctcatctac
atggtcaacatctccagagaggacaaccctgcagaattcatagtctataatgtgacctac
aaggaacccaggctgagcttcccgatcaacatcctgacgtcagggctgtactatagggca
cgtgtgagggtcaaagtgcagacgttcacgggcacctggagtgagtggagtcctgacatc
acgtggtacaaccacttccagccacccctgatacagcgcctcccactgggggtcaccatc
tcctgcctctgcatcctcctgttttgcttgttctgttacttcagcattaccaagattaag
aagatatggtgggaccagattcccaccccagcacgcagtcccttggtggccatcatcatt
caggatgcacaggtgcccctctgggataagcagacccgaagccaggagtcaaccaagtgc
ccgcgctggaagacttgtctagccaagctgctgccctgcttgctggagcacagagtaaag
aagaagacagaattcccgaaggctgccccaaccaagtctctccagagtcctggaaaggca
atctggtgtcctatggaggtcagcaggaccgtcctctggccagagaatgttaatgtcagt
gtggtgcgctgtatggagctgtttgaggcccccgtacagagtgtggaggaggaagaagat
gagacggtcaaaggggacctgagcatgtcacctgagaacagcggaggcggcttccaggag
agccaggcagacatcatggcccggctcactgagaacctgttttcggacttgttggaggct
gagaatgggggccttggccagtcaggcttggcagagtcatgctcccctctgccttcagga
agtgggcaggcttctgtgtcctggacctgcttccctgtggggcccagtgaggaggccaca
ggccaggtcacagagcagccttcacacccaggccctctttcaggcagcccagcccagagt
gcacctaccctggcttgcacacaggtcccacttgtccttgcagacaatcctgcctaccgg
agttttagtgactgctgcagcccggccccagatcctggagagctggctccagagcagcag
caggccacacatctggaagaagaggtccctcgaagcctggctgtcctccgttcttcagga
ccaccaatgcagcaagtggagagctgggagcagattcttcacatgagtgtcctgcagcat
ggggcagctgctggctctgccccagcccctgccggtggctaccaggactttgtgcaggca
gtgaagcagggtgctgttcaggagcctggggtgcctggtgccgggccttccggagacccc
ggttacaaggccttctcgagcctgcttggcagcaatggtgtccgcacggacacagcagca
gcggggactgatagtgggcatggaggctacaagcccttccagaatcctgttcctaaccag
tccccgagctccgtgcccttatttactttcggactagacacagagctgccgcccagtcct
ctgaactcagacccaccccaaagcaccccagaatgccttggtctggagctggggctcaaa
ggaggtgactggctgaaggcccctcctcctgcagatcaggtgcccaagcccttcggggat
gacctgggctttggcattgtgtactcgtccctcacctgccacttgtgcggccacctgaag
caacaccacagcccggaggaaggaggccagagccctgtccttgctagccctggctgtggc
tgctgctacgatgacagatcaccatccctggggagcctctcgggggccttggaaagctgt
cctgagggaatgccaccagaagccaacatcatgtcagcacccaagacaccctcaaacttg
tcaggggagggaaagggccctggtcactctcctgttcccagccagaccactgaggtgcct
gtgggcaccctgggcattgctgtttcttag

KEGG   Mus pahari (shrew mouse): 110323469
Entry
110323469         CDS       T05929                                 

Gene name
Mpl
Definition
(RefSeq) thrombopoietin receptor isoform X1
  KO
K05082  thrombopoietin receptor
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110323469 (Mpl)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110323469 (Mpl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110323469 (Mpl)
   04090 CD molecules [BR:mpah04090]
    110323469 (Mpl)
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  Prolactin receptor family
   110323469 (Mpl)
CD molecules [BR:mpah04090]
 Proteins
  110323469 (Mpl)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind Tissue_fac
Other DBs
NCBI-GeneID: 110323469
NCBI-ProteinID: XP_021056364
Ensembl: MGP_PahariEiJ_G0028707
LinkDB
Position
6
AA seq 633 aa
MPSWALFTVTSCLLLALPNQAQVTSQDVFLLALGTEPLNCFSQTFEDLTCFWNEEEAAPR
GTYQLLYAYRGEKPRACPLYSQSVPTFGTRYVCQFPAQDEVRLFFPLHLWVKNVSLNQTL
IQRVLFVDSVGLPAPPRVIKARGGSQPGELQIHWEAPAPEISDFLRHELSYGPTDSSNAT
ARSIIQLLSTETCCPTLWMPNPVPVHDQPPCVHPTASQQHGPLRTSPAGEAPSLTVKGGS
CLVSGLQAGKSYWLQLRSQPDGVSLRGSWGPWSFPVTVDLPGDAVTIGLQCFTLDLKTVT
CQWQQQDRTSSRGFFRHSQMRRCPTDRDPAWERCEEEDLRPGSQPTLFSRCHFKSRNDSV
IHILIEVTTAQGAIHSYLGSPFWIHQAVVLPTPSLHWREVSSGRLELEWQHQSSWAAQET
CYQLRYTGEGREDWKVLEPSLGARGGTLELRPRARYSLQLRARLNGPTYQGPWSAWSPPA
RVSTGSETAWITLVTALLLVLSLSTLLGLLLLKWQFPAHYRRLRHALWPSLPDLHRVLGQ
YLRDTTALSPSKATVTDICEEVEPSLLEVLPKSSESAPLPLCPSQPQMDYRGLQPCLRTM
PLSVCPPTAETGSCCTTHIANHSYLPLSYWQQP
NT seq 1902 nt   +upstreamnt  +downstreamnt
atgccctcttgggccctcttcacggtcacctcctgcctcctcttggcccttccaaaccag
gcacaagtcaccagccaagatgtcttcttgctggccttgggcacagagcccctgaactgc
ttctcccaaacatttgaggacctcacctgcttctggaatgaggaagaggcagcacccaga
gggacataccagctgctgtatgcctaccgaggagagaagccccgggcatgccccctgtat
tcccagagtgtgcccacctttggaacccggtatgtgtgccagtttccagcccaggatgaa
gtgcgtctcttctttcccctgcacctctgggtgaagaatgtgtccctcaaccagactttg
atccagcgggtgctgtttgtggatagtgtgggcctgccagctccccccagggtcatcaag
gccaggggtgggagccaaccaggggaacttcagatccactgggaggcccctgctcctgaa
atcagtgacttcttgaggcatgaactcagctatggccccacggactccagcaacgccact
gcccgctccatcattcagctgctctccacagaaacctgctgccccactttgtggatgccg
aacccagtccctgttcatgaccagcctccgtgtgttcatcctacagcatcccaacagcat
ggaccattgaggacctccccagctggagaagctccatctctgacagtgaagggtgggagc
tgtctcgtctcaggcctccaggctggcaagtcctactggctccagctacgcagccaaccc
gacggggtctcccttcgtggctcctggggaccctggtccttccctgtgactgtggatctt
ccaggagatgcagtgacaattggacttcaatgctttaccttggatctgaagacggttacc
tgccagtggcagcaacaagaccgcactagctccagaggcttcttccgtcacagccagatg
cggcgctgccccacagaccgggaccccgcctgggaaagatgtgaagaggaggatctgcgt
ccaggatcacagcccactctcttctcccgctgccacttcaaatcacgaaatgacagtgtt
attcacatccttatagaggtgaccacagcgcaaggtgccattcacagctacctgggctcc
cctttttggatccaccaggctgtggtcctccccaccccgagcctgcactggagggaggtc
tcaagtggaaggctggagttggagtggcagcaccagtcatcttgggcagctcaagagacc
tgctaccagctccggtacacgggagaaggccgtgaggactggaaggtgctggagccgtct
ctcggagcccggggagggaccctagagctgcgcccccgagctcgctacagcttgcagctg
cgtgccaggctcaacggccccacctaccaaggtccctggagtgcctggtctcctccagct
agggtgtccacgggctccgagactgcttggatcaccttggtgactgctctgctcctggtg
ctgagcctcagtacccttctgggcctactgctgctgaagtggcaatttcctgcgcactac
aggagactgaggcatgctttgtggccctcgcttccagacctacaccgggtcctaggccag
tacctcagagacactacggccctaagtccttctaaggccacagttaccgatatctgtgaa
gaagtggaacccagtctcctagaagtgctccctaagtcctcagagagtgctcctttaccc
ctgtgtccctcccagcctcagatggattacagaggactgcaaccttgcctacggaccatg
cccctgtctgtgtgtccacccacggctgagacagggtcctgctgcaccacacacattgcc
aaccactcctatctaccgctaagctattggcagcagccctga

KEGG   Mus pahari (shrew mouse): 110323524
Entry
110323524         CDS       T05929                                 

Gene name
Il22ra1
Definition
(RefSeq) interleukin-22 receptor subunit alpha-1
  KO
K05138  interleukin 22 receptor alpha 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04061  Viral protein interaction with cytokine and cytokine receptor
mpah04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110323524 (Il22ra1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110323524 (Il22ra1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    110323524 (Il22ra1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110323524 (Il22ra1)
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  IL10/28 receptor family
   110323524 (Il22ra1)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 110323524
NCBI-ProteinID: XP_021056449
Ensembl: MGP_PahariEiJ_G0028976
LinkDB
Position
6
AA seq 580 aa
MKTLLTILTVGSLAAHTTVNTSGLLQHVKFQSSNFENILTWDGGPASTSDTVYSVEYKKY
GEKKWLAKAGCQRITQKFCNLTMETRNHTEFYYAKVTAVSAGGPPVTKMTDRFSSLQHTT
IKPPDVTCIPKVRSIQMLVHPTLTPVLSEDGRQLTLEEIFHDLFYHLELHVNHTYQMHLE
GKQREYEFLGLTPDTEFLGSITILTPILSKESAPYVCRVKTLPDRTWAYSFSGVVLFSMG
FLVGLLCYLGYKYITKPPVPPNSLNVQRVLTFQPLRFIQEHVLIPVLDLSGPSSLPQPIQ
YSQVVVSGPREPPGAVRRQSLSDLTYVGQSDVSILQPPNVPAQQILSPPSYAPKAVPEVQ
PPSYAPQVASDAKALFYSPQQGMKTRPATYDPQDILDSCPASYAVCVEDSGKDSTPGILS
SPKYLKTKGQLQEDTLVRCLPGDLYLQKVTSLGKGEVQRPKSLPSPLGFCTDRGPDLHTL
HSEEPETPRYLKGALSLLSSVQIEGHPVSLPLHIHSVSCSPSDEGPSPWGLLDSLVCPKD
EGPTVETEAMSPSAAASELEQSTELDSLFKGLALTVQWES
NT seq 1743 nt   +upstreamnt  +downstreamnt
atgaagacactactgaccatcctgacggtgggatccctggctgctcacaccactgtgaac
acatccggtctccttcaacacgtgaaatttcagtccagcaactttgagaacatcttgacg
tgggatggtgggccagctagcacctctgacaccgtctacagtgtggaatataagaagtac
ggagagaaaaagtggctggccaaggcaggctgccagcggatcacccagaagttctgcaac
ttgactatggagacccgcaaccacaccgagttttactacgccaaggtcactgcggtcagc
gcaggaggcccaccggtcacaaagatgactgatcgtttcagttccctgcagcacactacc
atcaaaccacctgatgtgacctgtatccccaaagtgaggtccattcagatgctggtccac
cccacactcacacctgtcctctcggaagatggccgtcagctaaccctggaggagattttc
catgacctgttctaccacttagagctccacgtcaaccacacctaccagatgcaccttgaa
ggcaaacagagagaatatgagttccttggcctgactcccgacacagagttcctcggctcc
atcacaattttgactccgatattgtccaaggagagtgccccctacgtgtgccgagtgaag
acgctgcccgatcggacgtgggcctactccttctcgggcgtggtgctcttctccatgggt
ttcctcgttggcttgctctgttatctgggctacaaatatatcaccaagccacctgtacct
cctaactccctgaacgtccagcgtgtcctcacctttcaacctctacgcttcatccaagaa
cacgtgctgatccctgtcttggacctcagcggccccagcagtctgcctcagcccatccag
tactcccaagtggtggtgtctgggcccagggaacctcctggagctgtgcggaggcagagc
ctgtctgacctcacctacgtagggcagtcggacgtctccatcctgcaacctcccaacgta
ccagctcagcagatactgtccccgccatcctacgctccgaaggctgtccctgaggtccag
cccccttcctatgcgcctcaggtagcctcggatgccaaagctctgttctactccccacaa
caggggatgaagaccaggcctgccacctatgacccgcaggacattctggacagctgtcct
gcttcctacgctgtgtgtgtggaagactctggcaaagactctaccccgggcatcctctcc
agtcccaaatacctcaagacgaaaggtcagctccaggaagacacacttgttagatgtctc
ccaggggacctttatctacagaaagtcacctccttaggtaaaggggaggtgcagagacca
aaatcactcccctcacctctggggttttgcacagatagaggacctgacctccacacactg
cacagtgaggaaccagagacaccacggtacctgaagggggcgctgtccctcctgtcctct
gtgcagatcgagggccaccctgtctccctccctttgcacatccattctgtctcatgttcc
ccctcagacgagggaccaagtccctggggcctgctggactccctcgtgtgtccaaaggat
gagggtcccacggttgagactgaggccatgagccccagtgctgcagcctctgagctggag
cagtccacagaactggactctcttttcaaaggcttggccctgactgtgcagtgggaatcc
tga

KEGG   Mus pahari (shrew mouse): 110323626
Entry
110323626         CDS       T05929                                 

Gene name
Csf3r
Definition
(RefSeq) granulocyte colony-stimulating factor receptor isoform X1
  KO
K05061  granulocyte colony-stimulating factor receptor
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04151  PI3K-Akt signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04640  Hematopoietic cell lineage
mpah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110323626 (Csf3r)
   04151 PI3K-Akt signaling pathway
    110323626 (Csf3r)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110323626 (Csf3r)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110323626 (Csf3r)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110323626 (Csf3r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110323626 (Csf3r)
   04090 CD molecules [BR:mpah04090]
    110323626 (Csf3r)
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  Prolactin receptor family
   110323626 (Csf3r)
CD molecules [BR:mpah04090]
 Proteins
  110323626 (Csf3r)
SSDB
Motif
Pfam: Lep_receptor_Ig fn3 IL6Ra-bind EpoR_lig-bind ObR_Ig
Other DBs
NCBI-GeneID: 110323626
NCBI-ProteinID: XP_021056611
Ensembl: MGP_PahariEiJ_G0028795
LinkDB
Position
6
AA seq 837 aa
MVGLGACTLTGVTLIFLLLPRSLESCGHIRISPPVVRLGDPVLASCTVSPNCSKLDQQPK
ILWRLQDEPNQPGDRQHRLPDGTQESLITLPHLNYTQAFLFCLVPWNDSVQVLDQAELRA
GYPPASPSNLSCLMHLTTNSLVCQWEPGPETHLPTSFILKSFRSRANCQYQGGTIPDCEA
KKRQNNCSIPRRHLLLYQNMVIWVQAKNMLGSSVSPKLCLDPMDVVKLEPPMLQALDIGP
DVVSHQPGCLWLSWKPWKPSEFMEQECELRYQPQLEGANWTLVSHLPSSKDHFELCGLHQ
APVYTLQMRCIRSSLPGFWSSWSPDLQLRPTIKAPTIRLDTWCQKNQLDPGTVSVQLFWK
PTPLQEDSGQIQGYLLSWSSPDQQGQDIHLCNTTELSCIFLLPSEAQNVTLVAYNKAGTS
SPTPVVFLENEGPAVTGLHAMAQDLDSIWVDWEAPILLPQGYLIEWGMNSHSYNNSYKSW
RIELDGNITGILLEDNIDPFQLYRITVAPLYPGTVGPPVNVYVYVGERALPQAPELHLKH
VGTTWAQLEWVPKSSWLGMVPLTHYTIFWADTGDHSFSVTLNISCHGFVLKHLEPASWYH
VYLMATSRAGSTNSTGLTLKTLALDSSDINIFLGTLCLILFLSIACVAACFCKHSRKTFF
WSNVPDPAHSSLSSWLPTIMTEETFQLPSFWDSSVPSITKITELEEDKKPTHWDSESSGN
GSLPALVQAYVLQDPREISKQFQPPSGTGDQVLYGQVLESPTSPGVVQYIRCDSTQPLLG
GPTPSPKSYENIWFHSRPQTFVPQPPSQEDDCVFGPPFDFPLFQGLQVHGVEEQGGF
NT seq 2514 nt   +upstreamnt  +downstreamnt
atggtagggctgggagcctgcaccctgactggagttaccctgatcttcttgctactcccc
agaagtctggagagctgcggacacatcaggatctcaccccctgttgtccgcctgggggac
cctgtcttggcctcctgcacagtcagcccaaactgcagcaaactggaccaacagccaaag
atcctatggagactgcaagatgagcccaaccaaccaggggacagacagcatcgtctgcct
gatgggacccaggagtccctcatcactctgcctcacctgaactacacccaggccttcctc
ttctgcttagtgccatggaacgacagtgtccaagtcctggatcaagctgagcttcgtgca
ggctatccccctgccagcccctccaacctatcctgcctcatgcacctcaccaccaacagc
ctggtctgccagtgggagccaggccccgagacccacctgcccaccagcttcatcctaaag
agcttcaggagccgcgccaactgtcagtaccaagggggcaccatcccggattgtgaggcc
aagaagaggcagaacaactgctccatcccccgcagacacttgctcctgtaccagaatatg
gtcatctgggtgcaagcaaagaatatgctagggtccagcgtgtcgccaaagctgtgcctc
gaccccatggatgttgtgaaattggagcctcccatgctgcaggccctggacattggccct
gatgtagtctctcaccagcctggctgcctgtggctgagctggaagccatggaagcccagt
gagttcatggagcaggagtgtgaactccgctatcagccacagctcgaaggagccaactgg
actctggtgtcccacctgccttccagcaaggaccactttgagctctgcgggctccatcag
gccccagtctacaccctacagatgcgatgcatccgctcatctctgcctggattctggagc
tcctggagccctgacctgcagctgaggcccaccattaaggcccccaccatcagactggac
acatggtgtcagaagaatcaactggatccagggacagtgagtgtgcagctgttctggaag
ccaacgcccctgcaggaagacagtggacagatccagggctacctgctgtcctggagttcc
ccagatcagcaagggcaggacatacacctttgcaacaccacggagctcagctgtatcttc
ctcctgccctcagaggcccagaatgtgacccttgtggcctacaacaaagcggggacctct
tcacctactccagtggttttcctggagaacgaaggtccagctgtgaccggactccatgcc
atggcccaagaccttgatagcatctgggtagactgggaagcccccatccttctgcctcag
ggctatctcattgagtggggcatgaattcgcacagctacaataacagctataagtcctgg
aggatagaacttgacgggaacatcactggaattctgttagaggacaacatagatcccttt
cagctctacagaatcacagtggctcccctgtacccaggcaccgtgggaccccctgtaaat
gtctacgtctacgttggagagagagctcttcctcaggctccagagctacatctaaagcat
gttggcacaacctgggcacagctggagtgggtacctaagagctcttggctggggatggta
cccctcacccactacaccatcttctgggccgatactggggaccactccttctccgtcacc
ctgaacatctcctgccatggctttgtcctgaaacacttggagcctgccagttggtatcat
gtctacctcatggccaccagtcgagcggggtccaccaacagtacgggccttaccctgaag
accctggccctagattcatctgacataaacattttcctgggcacactttgcttaatactt
tttttgtccattgcctgtgtagctgcctgcttctgcaagcacagcagaaagactttcttc
tggtcaaatgtgccagacccagcccacagtagcctgagctcctggttgcctaccatcatg
acagaggaaaccttccagttgcccagcttctgggactccagcgtgccgtcaatcaccaag
atcactgaactggaggaagacaagaaaccaacccactgggattccgaaagctctgggaat
ggtagccttccagccctggttcaggcctacgtgctccaagatccaagagaaatctccaag
cagttccagcctccctctggcactggtgaccaggtcctctatggtcaggtgcttgagagc
cccaccagcccaggagtagtgcagtacattcgctgtgactccactcagccccttttgggg
gggcccacccccagccctaaatcttatgaaaacatctggttccattcaagaccccagacc
tttgtgccccagcctccaagccaggaagatgactgtgtctttgggcctccatttgatttt
cccctcttccaggggctccaggtccatggagttgaagaacaagggggtttctag

KEGG   Mus pahari (shrew mouse): 110323717
Entry
110323717         CDS       T05929                                 

Gene name
Ifnlr1
Definition
(RefSeq) interferon lambda receptor 1 isoform X1
  KO
K05140  interferon lambda receptor 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110323717 (Ifnlr1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110323717 (Ifnlr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110323717 (Ifnlr1)
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  IL10/28 receptor family
   110323717 (Ifnlr1)
SSDB
Motif
Pfam: Tissue_fac fn3
Other DBs
NCBI-GeneID: 110323717
NCBI-ProteinID: XP_021056733
Ensembl: MGP_PahariEiJ_G0028975
LinkDB
Position
6
AA seq 529 aa
MWRADRWAPLLLFLLQSALGRPRLAPPRNVTLFSQNFTVYLTWLPGLGSPPNVTYFVTYQ
SYTKPGWRRVEHCAGIKALVCPLMCLKRLNLYSKFKGRVQAASAHGKSPRVESRYLEYLF
DVELAPPTLVLTQMEKILRVNATYQLPPCMPSLELKYQVEFWKKGLGSKTLFPDTPYGQP
VQIPLQQGASGRHCLSARTVYTLIDIKYSLFSEPSCIFLEGPGANRAVLAVPSLLLLLIA
AVAAGVAWKKMKGNPWFQGVKTPRALDFSEYRYPVATFQPSGPEFSDDLILCPQKELTIR
IKPAPQVRDPATLQAGPEKDSTEDEDEDTDDDGDSVQPYLERPLFISEKPRVMEHSETDD
SGVDSGGPWASPGGSEGPSAWDSSDRSWSSTGDPSYKDEAGSSSRLDRKEPDQAPCGDPR
QEALPCLEFSEDLGTVEELLKDDLSRWRIWGSLSPKRDLAPVEPPVSLQTLTFCWASNPE
GEEEEEEEEEEEEEDWESEPKGSNAGCWGTSSLQRTEVRGQMLGDYLVR
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgtggcgggccgaccggtgggcgcccctactcctgttcctgttgcagagcgccctagga
aggccccgtctagccccacccagaaacgtgacactgttctcccagaacttcactgtttac
ctgacatggcttccggggcttgggagccccccaaacgtgacctattttgtgacctaccaa
agctataccaagccgggttggcgaagagtggagcattgtgcaggcatcaaggctctggtg
tgtcccctgatgtgcctgaagagactgaacctgtactccaagttcaaaggacgagtacag
gcagcttcggcacacggcaagtccccacgggtggagtcccggtacctggaataccttttt
gacgtggagctagccccgcccaccctggtgctcacccagatggagaagattctaagggtc
aacgctacctaccagctgccgccttgcatgccctcgctggaactgaagtaccaggtggaa
ttctggaagaagggcctgggaagcaagaccctgtttcctgacactccctatggccagcca
gtgcagattcctctccagcaaggtgctagcggacgccactgcctcagcgccagaaccgtc
tataccttaattgacattaagtacagcctgttctctgagcccagctgcatcttcctagag
ggcccaggggccaacagggctgtcctggcggtgccctcactcttgcttctactgatagca
gcggttgcagcgggtgtggcatggaagaaaatgaaagggaacccctggtttcagggggtg
aagacaccccgggcactggacttttctgaatacagatacccagtggcgacctttcagccc
agtggacctgagttctcagatgacttgatcctctgtccccagaaggagctgaccataagg
atcaaaccagcccctcaggtcagagacccggccacgctacaggcggggccagaaaaagac
agtactgaggatgaagacgaggacacagatgatgacggtgacagcgtccagccctacctg
gaacggcctctcttcatcagcgagaagccccgggttatggagcactcggagacagacgac
tctggggtggattcaggggggccttgggcatccccaggtggaagcgaaggcccatctgca
tgggactcttcagacaggagctggtccagcacgggggacccctcatacaaggacgaagct
gggtcttccagccgtttggaccgaaaggagccggaccaggcgccctgtggggatccgcgc
caggaagctctcccgtgcctggaattttctgaggacttgggcaccgtggaggagcttctg
aaggatgacctctctaggtggagaatttggggttccttatccccaaagagagatctggct
cctgtggagcccccagtttctcttcagacactgactttctgctgggccagcaatcctgag
ggggaggaggaagaggaagaagaagaggaagaggaggaagaagactgggaatcagaacct
aagggcagcaacgccggctgttggggcacttcaagcctgcagaggacagaggtcaggggc
cagatgctgggagattacttggtcaggtga

KEGG   Mus pahari (shrew mouse): 110325021
Entry
110325021         CDS       T05929                                 

Definition
(RefSeq) interleukin-3 receptor subunit alpha-like
  KO
K04737  interleukin 3 receptor alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04151  PI3K-Akt signaling pathway
mpah04210  Apoptosis
mpah04630  JAK-STAT signaling pathway
mpah04640  Hematopoietic cell lineage
mpah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110325021
   04151 PI3K-Akt signaling pathway
    110325021
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110325021
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110325021
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110325021
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110325021
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110325021
   04090 CD molecules [BR:mpah04090]
    110325021
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  IL3 receptor family
   110325021
CD molecules [BR:mpah04090]
 Proteins
  110325021
SSDB
Motif
Pfam: IL6Ra-bind IL3Ra_N
Other DBs
NCBI-GeneID: 110325021
NCBI-ProteinID: XP_021058482
Ensembl: MGP_PahariEiJ_G0029976
LinkDB
Position
8
AA seq 395 aa
MATNLWLLLGLLTSQSSELAATREAPPTVVTTLIRNLRIDPAHRTLSWDPAPSTDITTEF
ACRKDGDLFSVRGGAWADPGLTRCSFPSLSLCRSTDFAVLLGEDRVEVGSIRFPPDDGGD
REAAAKDLRCWVHDVGRLSCRWERGPRAAGDVRYRMFWRDTQLDPTHDRECPHYHSDDVT
ATGPAPHGGHEGCTLDLDPDLGSDTQVDVTVNGSGHAGPVPCMDDTMDLQHVEVLVPPTL
KVECSGSDAHVQWFPQTRFHHNLLGFTLQVNQSSRPVLQEFNFSTTHFRVPNAGAITFRV
RARSEVDPGKLSGWSNTWGLVCPLEVKSMTTVLVTSAAVVLGTGLIAAGFLLCWRKSLLS
RLCPPIPHLRLPLAGETVAWAPAPEDCEVTPVTDA
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggccaccaacctgtggctcctcctggggctgctgacatcacagtcttcagagctggct
gccacccgcgaggccccgcccactgttgtgaccacgctcatccggaacctgcgcatcgac
cccgcccatcgcacactgagctgggaccccgcccccagcactgacatcacaacagagttt
gcctgcaggaaggacggggacctattttcggtgaggggcggggcctgggccgacccgggg
cttacccgctgctcgttcccgtcgctctccctctgccgctcgaccgactttgccgtcctc
ctgggggaggacagggtggaggtcggatccatccggttccccccagatgacggtggcgac
cgcgaggctgcggccaaggacctgcgctgctgggtgcatgacgtggggcggctgagctgc
cgctgggaacggggccccagggctgcgggcgatgtgcgctaccggatgttctggcgtgac
acgcagctcgatcccacccatgaccgcgagtgtccacactaccacagcgatgatgtcact
gccactggccccgcccctcatggtggccatgaagggtgcaccctcgacctcgaccctgac
cttggctctgacacccaggtcgatgtcactgtcaacggcagcggccatgcgggccccgtg
ccctgcatggatgacaccatggacctgcagcatgtggaggtcctggtcccgcccacgctg
aaggtcgagtgcagcggctctgatgcccatgtgcaatggttcccgcagacccggttccac
cacaacctcctcgggttcaccctgcaggtcaaccagagctcacgcccagtgctgcaggaa
ttcaatttctccaccacccacttccgggtccccaacgctggtgccatcaccttccgggta
agggcgaggtcagaagttgacccagggaagctaagcggctggagcaacacctggggccta
gtctgccccctcgaggtgaagtctatgacgacggtactggtgacatcggcagctgtggtt
ctggggacagggctcatagcagctgggttcctgctgtgctggaggaagtcgctgctgtcc
cgcctgtgtccacccatcccgcatctgcgcctgcccttggcaggggagacagttgcatgg
gccccggcgcccgaggactgtgaggtgacgcctgtgacggacgcctga

KEGG   Mus pahari (shrew mouse): 110327772
Entry
110327772         CDS       T05929                                 

Gene name
Il10ra
Definition
(RefSeq) interleukin-10 receptor subunit alpha isoform X1
  KO
K05134  interleukin 10 receptor alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04061  Viral protein interaction with cytokine and cytokine receptor
mpah04630  JAK-STAT signaling pathway
mpah05145  Toxoplasmosis
mpah05152  Tuberculosis
mpah05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110327772 (Il10ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110327772 (Il10ra)
   04061 Viral protein interaction with cytokine and cytokine receptor
    110327772 (Il10ra)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110327772 (Il10ra)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    110327772 (Il10ra)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110327772 (Il10ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110327772 (Il10ra)
   04090 CD molecules [BR:mpah04090]
    110327772 (Il10ra)
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  IL10/28 receptor family
   110327772 (Il10ra)
CD molecules [BR:mpah04090]
 Proteins
  110327772 (Il10ra)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 110327772
NCBI-ProteinID: XP_021062628
Ensembl: MGP_PahariEiJ_G0015012
LinkDB
Position
10
AA seq 575 aa
MSSRLLPFLVTISSLSLEFIAHGTELPSPSHVWFEARFFQHILRWTPIPSQSESTYYEVA
LKQYGNSTWNDIHICRKAQALSCDLTTFTLDLYRRGYGYRARVRAVDSSQYSNWTTTKTR
FTVDEVILTVDSVTLKVTDGIIYGTIHPPRPSITPAGDEYEQVFKDHRAYRVSIRKFSEQ
KNTTKTVNQERFTLTVPIGVRKFCVKVLPRVETRINKAEWSEEQCLLIMTEQSFTVTNLS
ILVISILLFCGVLVCLALQWYIRHPGKLPAALVFKKPHDFFLADPLCPETPDAIHILDLE
AFPKVSPELRDSDLHGSTDSGFGSGKPSLQTEESQFLLPGSHPQIQGTLGKEEPPELRAT
CGDNTDSGICLQEPSLHSSLGPSWKQQLGYTHQDQDDSDVNLVQNSPGQPKYTLDASASS
PVCLLEPKVPEEKDQIMVTFQGYQKQTRWQEEAADPAERLDEEIPLTDAFDPELGVHLQD
DFAWPPPALAAGYLKQESQGMASAPPGTPSRQWNQLAEEWSLLDVVSCEDLSIESWRFAH
KLAPLDCGSAPGSLLDSLGSNLVSLPLISSLQVEE
NT seq 1728 nt   +upstreamnt  +downstreamnt
atgtcctcgcgtttgctcccattcctcgtcacgatctccagcctgagcctggaattcatt
gcacacgggacagagctgccaagcccttcccacgtgtggtttgaagccagatttttccag
cacatcctccgctggacgcctatcccaagccagtctgagagcacctactacgaagtggcc
ctgaagcagtacggaaactcgacctggaatgacatccacatctgtagaaaggctcaggcg
ttgtcctgcgatctcacaacgttcaccctggatctgtatcgccgaggctatggctaccgg
gccagagtccgggcagtggacagcagtcaatactccaactggaccaccaccaagactcgc
ttcacagtagacgaagtgattctgacggtggatagcgtgaccctgaaagtaaccgatggc
atcatctacgggacaattcatccccccaggccctcgataacccctgcaggggatgagtac
gaacaggtcttcaaggatcaccgcgcttacagggtttccatccggaagttctcggaacag
aagaatacaaccaagacagtgaatcaggaacgcttcaccctcacggtccccataggggtg
cgaaagttttgtgtcaaggtgctgccccgcgtggagacccgaatcaacaaggcagagtgg
tcggaggagcagtgtttacttatcatgacggagcagtctttcactgtgaccaacctcagc
atcttagtcatatctatcctgctattctgtggagtcctggtctgtctggctctccagtgg
tacatccggcacccggggaagttgcctgcagccctggtcttcaagaagcctcatgacttc
ttcctggccgaccctctctgcccagaaactcccgatgccattcacatcctggacctggag
gctttcccaaaggtgtcaccagagctgagagactcagacctgcatggcagcaccgacagt
ggctttggcagtggcaaaccatcacttcagactgaagagtcccaattcctcctccctggc
tcccacccccagatacaggggactctgggaaaagaagagcctccagagctacgggccacc
tgtggggacaacacggacagtgggatctgccttcaggagcccagcttacactccagcctg
gggccctcctggaagcagcagcttggatatacccatcaggaccaggatgacagtgatgtt
aacctagttcagaactctccggggcagcctaagtacacactggatgcctctgcctcgagc
cctgtctgtctcttagagcctaaagtccctgaggagaaagaccaaatcatggtgacattc
cagggctaccagaaacagaccagatggcaggaggaggcagcagacccagcagaacgcttg
gacgaagagattcccttgacagatgcctttgatcctgaactcggggtacacctgcaggat
gatttcgcttggcctccaccagctctggccgcaggttatttgaaacaggagtctcaaggg
atggcctctgctccaccagggacaccaagtagacagtggaatcaactggccgaagagtgg
tcactcctggatgtggttagctgtgaagacctaagcatagaaagttggaggtttgcccat
aaacttgcccctctggactgtgggtcagcccctggtagcctcctggatagccttggctct
aacctggtcagcctgccgttgatctccagcctgcaggtagaagaatga

KEGG   Mus pahari (shrew mouse): 110328285
Entry
110328285         CDS       T05929                                 

Gene name
Epor
Definition
(RefSeq) erythropoietin receptor
  KO
K05079  erythropoietin receptor
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04151  PI3K-Akt signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04640  Hematopoietic cell lineage
mpah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110328285 (Epor)
   04151 PI3K-Akt signaling pathway
    110328285 (Epor)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110328285 (Epor)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110328285 (Epor)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110328285 (Epor)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110328285 (Epor)
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  Prolactin receptor family
   110328285 (Epor)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind PCSK9_C1 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 110328285
NCBI-ProteinID: XP_021063393
Ensembl: MGP_PahariEiJ_G0014756
LinkDB
Position
10
AA seq 507 aa
MDQLRVPLWPRVGPLCLLLAGAAWAPSPSLPDPKFESKAALLASRGSEELLCFTQRLEDL
VCFWEEEASSGMDFNYSFSYQLEGESRKSCRLHQAPTVRGSVRFWCSLPTADTSSFVPLE
LQVTEASGSPRYHRIIHINEVVLLDAPAGLLARRAEEGSHVVLRWLPPPGAPMTTHIRYE
VDVSAGNRAGGTQRVEVLEGRTECVLSNLRGGTRYTFAVRARMAEPSFSGFWSAWSEPAS
LLTASDLDPLILTLSLILVLISLLLTVLALLSHRRTLQQKIWPGIPSPESEFEGLFTTHK
GNFQLWLLQHDGCLWWSPGSSFPEDPPAHLEVLSEPRWAVTQAGDPGAEDEGPLLEPVGS
EHAPDTYLVLDEWLLPRTPCSENLSGPGVGVDPVTMDEASDTSSCPSDLASKPRPEGTSP
SSFEYTILDPSSQLLCPRALPPELPPTPPHLKYLYLVVSDSGISTDYSSGGSQGVHGDSS
DGPYSHPYENSLVPDSEPLRPSYVACS
NT seq 1524 nt   +upstreamnt  +downstreamnt
atggaccaactcagggtgcccctctggcctcgggtaggccccctctgtctcctacttgct
ggggcagcctgggcaccttcacccagcctcccggaccccaagtttgagagcaaagcggcc
ctgctggcatcccggggctccgaagaacttctgtgcttcacccaacgcttggaagacttg
gtttgtttctgggaggaagaggcgagctccgggatggacttcaactacagcttctcttac
cagctcgagggtgagtcacgaaagtcatgtcgcctgcaccaggctcccaccgttcgcggc
tccgtgcgtttctggtgttcactgccaacagcggacacgtcgagttttgtgccgctggag
ctgcaggtgaccgaggcttccggttctcctcgctatcaccgcatcatccatatcaatgaa
gtagtgctcctggacgcccccgcggggctgctggcgcgccgggcagaagagggcagccac
gtggtgctgcgctggctgccacctcctggggcacctatgaccacccacatccgatatgag
gtggacgtgtcggcaggcaaccgggcaggggggacacaaagggtggaggtcctggaaggc
cgcactgagtgtgtactgagcaacctgcgtggcgggacacgctacaccttcgctgttcga
gcgcgcatggccgagccgagcttcagcggattctggagcgcctggtctgagcccgcgtca
ctactgaccgctagcgaccttgaccctctcatcttgacgctgtctctcattctggtcctc
atctcgcttttgctgacggtactggccctgctgtcccaccgccggaccctgcagcagaag
atctggcctggcatcccgagcccagagagtgagtttgagggtctcttcaccacccacaag
ggtaacttccagctgtggctgctgcagcatgatggttgtctgtggtggagccctggaagc
tccttccctgaggatccacctgcccacctagaggtcctctcagagccacgctgggcagtg
actcaggctggggatccaggggcagaggacgaggggcccttactggagccagtgggcagt
gagcatgccccggacacctacctggtattggatgagtggttgctgccccggaccccatgc
agtgagaacctctcagggcctggggttggtgtggaccctgtgactatggatgaagcctca
gacacatcttcctgcccgtctgacttggcctcaaagcccaggccagagggcacctcacct
tccagctttgagtacaccatcctagaccccagctctcagctcctgtgccctcgggcactg
cctcccgagctccctcccacaccacctcacctgaaatacctgtaccttgtggtgtctgat
tctggcatctcaacagattacagttcggggggctcccagggagtccacggggactcatct
gatggcccctattcccacccctatgagaacagccttgtcccagactcagagcctctgcgt
cccagctacgtggcctgctcctag

KEGG   Mus pahari (shrew mouse): 110328622
Entry
110328622         CDS       T05929                                 

Gene name
Il20rb
Definition
(RefSeq) interleukin-20 receptor subunit beta
  KO
K05137  interleukin 20 receptor beta
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04061  Viral protein interaction with cytokine and cytokine receptor
mpah04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110328622 (Il20rb)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110328622 (Il20rb)
   04061 Viral protein interaction with cytokine and cytokine receptor
    110328622 (Il20rb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110328622 (Il20rb)
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  IL10/28 receptor family
   110328622 (Il20rb)
SSDB
Motif
Pfam: Tissue_fac fn3 Interfer-bind
Other DBs
NCBI-GeneID: 110328622
NCBI-ProteinID: XP_021063708
Ensembl: MGP_PahariEiJ_G0015438
LinkDB
Position
10
AA seq 308 aa
MISQGGWTSPVMWFFYSMSSGFLTDAVSVLPAPQNLSVQSTNMKHLLMWNPVTQPGETVF
YFVEYQGEYESLYMSHIWIPSSQCSPTKSLECDVTDDITATVPYNFRVMAMLGSQTSAWS
NLEYPFNRNATVLTPPRMEVTEHGLHLVIELEDLGPPFEFLVVYWRREPGAAEHVKVVRS
GDIPVHLETMEPGAMYCVKAQALVKAIGRHSAFSQPMCVEMQGESLPLALALFAFVGFTL
IFVVVLLSVWKMGQLLRYSCCPTVVLPDTLKITSSSQKLVNCRKEEVDACDVAVLSSEHL
FGVWISQT
NT seq 927 nt   +upstreamnt  +downstreamnt
atgatttcccagggaggctggacaagtccggtcatgtggtttttctacagcatgtcctca
ggttttctcactgatgcagtgtccgttttacctgcccctcagaacctctctgtacagtca
accaacatgaagcatctcttgatgtggaacccagtgacccagccgggggagacagtattc
tattttgtggagtatcagggggagtacgagagcctgtacatgagccacatctggatcccc
agcagtcagtgctcaccgaccaaaagtctggagtgtgatgtcaccgatgacatcaccgcc
acagtgccatataacttcagggtcatggccatgctgggctcacagacttcagcctggagc
aacctggagtacccctttaaccgaaatgcaactgtcctcaccccacccaggatggaggtc
actgaacatggactgcatctggttattgaactggaagacctggggcccccgtttgagttc
cttgtggtctactggaggagggagcctggcgccgcggaacatgttaaggtggtgaggagt
ggggacattccggtgcacctagaaaccatggaaccgggcgccatgtactgtgtgaaggcg
caggcgctggtgaaagccatcgggaggcacagtgccttcagccagcctatgtgtgtggag
atgcaaggagagtctcttccactggcactggctctgtttgcatttgttggcttcacgctg
atttttgtggtagtcctactctccgtctggaagatgggccagctgctccggtattcttgc
tgccccaccgttgtcctcccagacactttgaaaataaccagttcatcccagaagctggtc
aactgcaggaaggaggaggtggacgcctgtgacgtggctgtgctgtcctcggagcatctc
tttggggtctggatctcacagacttga

KEGG   Mus pahari (shrew mouse): 110328813
Entry
110328813         CDS       T05929                                 

Gene name
Ghr
Definition
(RefSeq) growth hormone receptor isoform X1
  KO
K05080  growth hormone receptor
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04080  Neuroactive ligand-receptor interaction
mpah04151  PI3K-Akt signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110328813 (Ghr)
   04151 PI3K-Akt signaling pathway
    110328813 (Ghr)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110328813 (Ghr)
   04060 Cytokine-cytokine receptor interaction
    110328813 (Ghr)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    110328813 (Ghr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110328813 (Ghr)
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  Prolactin receptor family
   110328813 (Ghr)
SSDB
Motif
Pfam: GHBP EpoR_lig-bind fn3 Cna_B
Other DBs
NCBI-GeneID: 110328813
NCBI-ProteinID: XP_021063943
Ensembl: MGP_PahariEiJ_G0016007
LinkDB
Position
11
AA seq 649 aa
MDLWRVFLTLALAVSSGTLSGSEATPATLGKASPVLQRINPSLGTSSSGKPRFTKCRSPE
LETFSCYWTEGDNPYFKTPGSIQLYYAKREGQQQAARIANTWTQEWKECPDYVSAGKNSC
YFNSSYTSIWIPYCIKLTTNGDLLDQKCFTVDEIVQPDPPIGLNWTLLNISLTGIRGDIQ
VSWQPPPNADVLKGWIILEYEIQYKEVNESKWKAMGPIWSTSFPVYSLRMDKEHEVRVRS
RQRSFEKYSEFSEVLRVIFPQTNILEACEEDIRFPWFLIIIFGIFGVAVMLFVVIFSKQQ
RIKMLILPPVPVPKIKGIDPDLLKEGKLEEVNTILGIHDNYKPDFYNDDSWVEFIELDID
DADVDEKTEGSDTDRLLSDDHEKSAGILGAKDGDSGRTSCYDPDILDTDFHTSDMCDGTL
ELTQSQKLNTEADLLCLDQKNLKNSPYDASLGPLHPSITLKTEDKPQPLLGSETESTHQL
ASTPMSNPTSLANIDFYAQVSDITPAGGVVLSPGQKIKAGIVQGNTQPEVATPCQENYSM
NSAYFCESDAKKCIAVAPCMEATSCVKPSFNQEDIYITTESLTTTARMSKTADTAPDAEM
PVPDYTTVHTVQSPRGLILNATALPLPDTKKFLSSCGYVSTDQLNKIMQ
NT seq 1950 nt   +upstreamnt  +downstreamnt
atggatctttggcgggtcttcttaaccttggcactggcagtctccagcggcacgttatct
ggaagtgaggctacaccagctactcttggcaaagcttccccagttctgcaaagaattaat
ccaagcctggggacaagttcttctggaaagcctcgattcaccaagtgccgttcccctgaa
ctggagacattttcatgctactggaccgaaggagataatccttatttcaagaccccagga
tctattcagctgtactatgctaaaagggaaggccaacaacaagctgcaagaattgctaat
acatggacccaggaatggaaagaatgccctgattatgtctctgctggaaaaaacagctgt
tacttcaactcatcatatacctccatttggataccctactgcatcaagctaactacaaat
ggtgatctgctggaccaaaagtgtttcactgttgacgaaatagtgcaacctgatccaccc
attggcctcaactggactttactaaacattagtttgaccgggattcgtggagacatccaa
gtgagttggcaaccaccacccaatgcagatgttctgaagggatggataattctggaatat
gaaattcagtacaaagaagtaaatgaatcaaaatggaaagcgatgggccctatatggtca
acatcctttccagtgtactcattgagaatggataaagaacatgaagtgcgggtgagatcc
agacaacggagctttgaaaagtacagcgagttcagcgaagtgctccgtgtaatatttcct
cagacgaacatactggaagcatgtgaagaagatatccggtttccgtggttcttaattatt
atctttggaatatttggagtagcagtgatgctatttgtagttatattttcaaagcagcaa
aggattaagatgctgattttacccccagtcccagttccaaagattaaagggattgatcca
gatcttctcaaggaagggaagttggaggaggtgaacaccatcttaggcattcatgataac
tacaaacccgacttctacaatgatgattcctgggtcgagttcattgagctagatattgat
gacgcagatgtggatgagaagactgaagggtctgacacagacagacttctaagtgatgac
catgagaaatcagctggtatccttggagcaaaggatggcgattctggacgtaccagctgt
tacgaccctgacattttggatactgatttccataccagtgatatgtgtgatggtaccttg
gagttgactcagtcacagaagttaaacacggaagctgatctcttgtgccttgaccagaag
aatctgaagaactcgccttatgatgcttcccttggccctctgcatccctccattaccctg
aaaacagaagacaagccacagccgcttttgggcagtgaaactgaatcaacccaccaactc
gcctctacacctatgagcaatcccacatcactggcaaacattgacttttatgcccaagta
agcgacattacaccagccggtggtgtagtcctttccccaggccaaaagattaaggcaggg
atagtccaaggcaacacccaaccggaggtggccacgccctgccaagaaaattacagcatg
aacagtgcctacttttgtgagtcagatgccaaaaagtgcatcgctgtggccccttgcatg
gaggccacgtcttgtgtaaaaccaagctttaaccaagaggacatttacatcaccacagaa
agccttaccactactgcccggatgtccaagacagcagatactgctccagatgctgagatg
cctgtcccagactacaccacggttcacacggtgcagtctccaaggggccttatactcaac
gcgactgctttgcctttgcctgacacaaagaagttcctctcctcctgtggctatgtgagc
acagaccaactgaacaaaatcatgcagtag

KEGG   Mus pahari (shrew mouse): 110328878
Entry
110328878         CDS       T05929                                 

Gene name
Il6st
Definition
(RefSeq) interleukin-6 receptor subunit beta
  KO
K05060  interleukin 6 signal transducer
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04061  Viral protein interaction with cytokine and cytokine receptor
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04630  JAK-STAT signaling pathway
mpah04659  Th17 cell differentiation
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05171  Coronavirus disease - COVID-19
mpah05200  Pathways in cancer
mpah05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110328878 (Il6st)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110328878 (Il6st)
   04061 Viral protein interaction with cytokine and cytokine receptor
    110328878 (Il6st)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110328878 (Il6st)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    110328878 (Il6st)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110328878 (Il6st)
   05203 Viral carcinogenesis
    110328878 (Il6st)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    110328878 (Il6st)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110328878 (Il6st)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110328878 (Il6st)
   04090 CD molecules [BR:mpah04090]
    110328878 (Il6st)
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  IL6/12 receptor family
   110328878 (Il6st)
CD molecules [BR:mpah04090]
 Proteins
  110328878 (Il6st)
SSDB
Motif
Pfam: Lep_receptor_Ig fn3 Pur_ac_phosph_N fn3_2
Other DBs
NCBI-GeneID: 110328878
NCBI-ProteinID: XP_021064031
Ensembl: MGP_PahariEiJ_G0015962
LinkDB
Position
11
AA seq 881 aa
MSALRIWLTQALLIFLTAESIGQLLEPCGYIYPEFPVVQRGSNFTAICVLKEKCLQHYDV
NASYIVWKTNHVAVPREQVTVINRTTSSVTFTDMVFQSVQLTCNILSFGQIEQNVYGVTI
LSGWLSGRATEKFPDCQSKHGTSCMVSYMPTYYVNMEVWVEAENALGKVSSESINFDPVD
KVKPIPPYNLSVTNSEELSSILKLSWVSSGLGGLLSLKSDIQYRTKDASTWIQVPLEDTM
SPRTSFTVQDLKPFTEYVFRIRSIKDSGKGYWSDWSEEASGTTYEDRPSKPPSFWYKINP
SHGQEYRSARLIWKALPLSEANGKILDYEVILTQSKSISQKYTVNGTELIVNLTNHRYVA
SLAARNKVGKSAAAVLTIPSPHVTASHPVVNLKAFPKDNLLWVEWTPPSKPVNKYILEWC
VLSENAPCIEDWQQEDANVNRTHLRGSLLGSKCYLITVTPVFTTGPGRPESLKAYLKQTA
PTRGPTVRTKKVGKNEAVLEWDQLPVDDQNGFIRNYSISYRTSVGKEMVVHVDPSHTEYT
LSSLSSDTLYMVRMAAYTDEGGKDGPEFTFTTPKFAQGEIEAIVVPVCLAFLLTTLLGVL
FCFNKRDLIKKHIWPNVPDPSKSHIAQWSPHTPPRHNFNSKDQMYSEGNFTDVSVVEIEA
NNKKPCPDDLKSLDLFKKDKVSTEGHSSGIGGSSCMSSSRPSISSNEENESAQSTASTVQ
YSTVVHSGYRHQVPSVQVFSRSESTQPLLDSEERPEDLQLVDNVDSGDEILPRQQYFKQN
CSQPEASPDISQFERSNQVSSGSEEDFVRLKQQQISDHISQPYGSEQRRLFQEGSTADAL
GTGTDGQIEGFASVGMETAIDEEIPKSYLPQTVRQGGYMPQ
NT seq 2646 nt   +upstreamnt  +downstreamnt
atgtcagcactaaggatttggctaacacaagctttgcttattttcctcaccgctgaatct
ataggtcaacttttggaaccgtgtggttatatctaccctgaatttccagttgtccagcgt
ggctctaacttcactgccatttgtgtgctaaaggagaaatgtctgcagcactacgacgtg
aatgccagctacatcgtgtggaagaccaaccatgtggctgtccccagggagcaggtcact
gtcatcaacagaaccacatccagtgtcacgttcacagacatggtcttccagagcgtccag
ctcacctgcaacatcctgtcctttggacagatcgagcagaatgtgtatggagtcaccata
ctttcaggctggttaagtggcagggcaacggagaagtttcctgattgtcagtcaaagcat
ggcacctcatgtatggtcagctacatgcccacttattatgtcaacatggaagtctgggtg
gaagcagagaacgcccttgggaaggtctcctcggagtctatcaattttgaccccgtggat
aaagtgaaacccatcccaccatataatttatcagtgaccaactcagaagaattatccagt
atattaaagctatcatgggtcagttcagggctgggcggtcttttaagtctgaagtccgac
atccaatataggaccaaagatgcctcaacttggatccaggtccctcttgaagatacaatg
tctccccgaacttccttcaccgtgcaggaccttaagccttttacagaatatgtgtttagg
atccggtccattaaggacagtgggaagggctactggagtgactggagtgaggaggctagt
gggaccacatacgaagacagaccatccaaaccaccaagtttctggtataagataaatcca
tcccatgggcaggaatatagatctgcacggctcatatggaaggcattacctctttctgaa
gccaatgggaaaatcttggattatgaagtgattcttacacagtcaaagtcaatttcacaa
aagtacacagttaacggcaccgagttgatagtaaatctcaccaatcaccgctatgtagca
tctctagcagcaagaaataaggtgggcaaatccgctgcagctgtcctcaccatccccagc
ccccacgtcacagcttcccatccggtagtgaatcttaaagcatttccaaaagataatctg
ctctgggtagagtggacgcctccatctaaacctgtgaacaaatacatcctagagtggtgt
gtgttgtccgagaacgcaccctgtatcgaagactggcagcaggaagatgctaacgtgaat
cggacccacttgagagggagcctcctggggagcaaatgctatctaattacggtgaccccc
gtgtttaccacggggcccggacgccctgagtccttgaaggcgtacctcaagcaaacagct
cctactagaggaccaactgttcggacaaagaaagtggggaaaaatgaagctgtcttagag
tgggaccaacttcctgtggatgaccagaatggatttattagaaactactccatatcttat
agaacaagcgttggaaaggaaatggtcgtgcatgtggatccttctcacacagagtacaca
ctgtcctctttgagtagtgacacgttgtacatggtccgaatggcagcatacacagatgaa
ggtgggaaagatgggccggaattcacttttacaacaccaaagttcgctcaaggagaaata
gaagccatagtcgtgcctgtgtgcttagcgttcctcctgacaactctgctgggagtcttg
ttctgctttaacaaacgagacctaataaaaaaacacatctggcctaacgttcctgatcct
tcaaagagtcatattgcccagtggtcacctcacacccccccaaggcacaattttaactcc
aaagatcaaatgtactcagagggcaatttcactgacgtaagcgttgtggaaatagaagca
aacaacaagaagccttgtccagatgacctgaagtccttggacctgttcaagaaggataaa
gtgagtacagaagggcacagcagtggcatcggggggtcctcgtgcatgtcctcctccaga
cccagcatctccagcaacgaggaaaatgagtctgctcagagtaccgccagcacggtgcag
tactccactgtggtgcacagcggctacaggcaccaggtcccatccgtgcaagtgttctca
aggtctgagtccacccagcccctgctagactccgaggagcggccagaagacctgcagctg
gtggacaatgtggacagcggggatgagatcttgcccaggcaacagtatttcaaacagaac
tgtagtcagcctgaagccagtccagatatttcacagtttgaaaggtcaaaccaggtttcc
tcgggcagcgaggaggattttgtcagactgaagcagcagcaaatttccgatcacatttcg
cagccctatggatccgagcaacggaggctgtttcaggaaggttctacagcggatgctctt
ggcacagggactgatggacagatagagggatttgcatctgttggaatggagacggcgatc
gatgaagaaattcccaaaagttacttgccacagactgtaagacaaggtggctacatgcca
cagtga

KEGG   Mus pahari (shrew mouse): 110328981
Entry
110328981         CDS       T05929                                 

Gene name
Prlr
Definition
(RefSeq) prolactin receptor isoform X1
  KO
K05081  prolactin receptor
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04080  Neuroactive ligand-receptor interaction
mpah04151  PI3K-Akt signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110328981 (Prlr)
   04151 PI3K-Akt signaling pathway
    110328981 (Prlr)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110328981 (Prlr)
   04060 Cytokine-cytokine receptor interaction
    110328981 (Prlr)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    110328981 (Prlr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110328981 (Prlr)
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  Prolactin receptor family
   110328981 (Prlr)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind
Other DBs
NCBI-GeneID: 110328981
NCBI-ProteinID: XP_021064160
Ensembl: MGP_PahariEiJ_G0016041
LinkDB
Position
11
AA seq 623 aa
MCCLYQEEGASLKKNMPSALAFMLLLLNISLLNGQSPPGKPEIHKCRSPDKETFTCWWTP
GSDGGLPTNYSLTYSKEGEKNTYECPDYKTSGPNSCFFSKQYTSIWKIYIIIVNATNEMG
SSASDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWSPPTITDVKTGWFTMEYEI
RLKSEEAEEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWSQEKSIEIPKDF
TLKDTTVWIIVAVLSAVICLIMVWAVALKGYSMMTCIFPPVPGPKIKGFDTHLLEKGKSE
ELLSALGCQDFPPTSDCEDLLVEFLEVDDNEDERLMPSHSKEYPGQGVKPTHLDPDSDSG
HGSYDSHSLLSEKCEEPKAYPPTFHIPEIAEKPENPEANIPPTPDPQSTTPNGHTDASRS
TACPLPPGQHMPRSPYHSIADVCKLAGSPIDTLDSFSDKAEENVLKSSEAPGEEEVAVQE
GAKSFPSNKQNTPRPLLQEKGPAVYAKPPDYVEIHKVNRDGVLSLLLKQRENHQTENPGV
PETGKEYAKVSGVTDNNILVLVPDSRAQNTALLGESVKKVPPSLEQNQSEKDLASFTATS
SNRRLQLGRLDYLDPTCFMHSFH
NT seq 1872 nt   +upstreamnt  +downstreamnt
atgtgttgcctgtatcaagaagaaggggccagcctgaagaaaaacatgccatctgcactt
gctttcatgctacttcttctcaacatcagcctcctgaatggacagtcaccacctggaaaa
cctgaaatccacaaatgtcgttcccctgacaaggaaacattcacctgctggtggactcct
gggtcagatggaggacttcccaccaattattcactgacttacagcaaagaaggagagaaa
aacacctatgaatgtccagactacaaaaccagtggccccaattcctgtttctttagcaag
cagtacacttccatatggaaaatatacatcatcatagtaaatgccacgaacgaaatggga
agcagtgcctcggatccactttatgtggacgtgacttacattgttgaaccagagcctcct
cggaacctgactttagaagtgaaacaactaaaagacaaaaaaacctatctgtgggtaaaa
tggtccccacccaccataactgacgtcaaaactggttggtttacaatggaatatgaaatt
cgattaaagtctgaagaagcagaagagtgggagatccattttacaggtcaccaaacacaa
tttaaggtttttgacttatatccaggacaaaagtaccttgtccagactcgctgcaagcca
gaccatggatactggagcagatggagccaggagaaatccattgaaataccaaaggacttc
accttgaaagatacaactgtgtggatcattgtggccgttctctctgctgtcatctgtttg
attatggtctgggcagtggctttgaagggctatagcatgatgacctgcatctttccacca
gttcctgggccaaaaataaaaggatttgatactcatctgctagagaagggcaagtctgaa
gaactgctgagtgccttggggtgccaagactttccccccacttctgactgtgaggacttg
ctggtggagttcttggaagtggatgacaatgaggacgagcggctaatgccatcccattcc
aaagagtatccgggtcaaggtgtgaaacccacacacctagatcccgacagtgactctggt
cacggaagctatgacagtcattctcttttgtctgaaaagtgtgaggagcccaaggcctac
ccccctaccttccacatccctgagatcgccgagaagccagagaatcctgaggcaaatatt
cctcccaccccagacccccaaagcaccacccccaatggtcatacagatgcatccagatct
acagcatgtcctttaccgcctggccagcacatgcccagatctccttaccatagcattgcc
gatgtgtgcaagctagctgggagtcctatagacacactggactctttctcagacaaagca
gaagaaaatgttctgaagtcgtctgaagcccctggagaggaagaagtggctgttcaagaa
ggggcaaaaagcttcccttctaacaaacaaaacacacctcggccgctgctccaggagaaa
ggccccgctgtctatgctaaacccccagattacgtggagattcacaaagttaacagagac
ggagtgctatcattactcctcaagcagagagaaaaccaccagacagaaaaccccggggtt
cctgaaaccggtaaggagtatgccaaggtgtccggggtcacagataacaacatcctggtg
ttagtgccagactcacgagcccagaacacagcgttgctcggggaatcagtcaagaaggtt
ccaccatcgcttgaacagaaccaatcagagaaagatctggccagctttactgcaacctca
agcaaccgcaggctccaactgggcaggctggattacctggatcctacatgcttcatgcac
tcctttcactga

KEGG   Mus pahari (shrew mouse): 110328984
Entry
110328984         CDS       T05929                                 

Gene name
Lifr
Definition
(RefSeq) leukemia inhibitory factor receptor isoform X1
  KO
K05058  leukemia inhibitory factor receptor
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110328984 (Lifr)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110328984 (Lifr)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110328984 (Lifr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110328984 (Lifr)
   04090 CD molecules [BR:mpah04090]
    110328984 (Lifr)
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  IL6/12 receptor family
   110328984 (Lifr)
CD molecules [BR:mpah04090]
 Proteins
  110328984 (Lifr)
SSDB
Motif
Pfam: LIFR_D2 LIFR_N fn3 Pur_ac_phosph_N IL6Ra-bind PhoD_N TMEM154
Other DBs
NCBI-GeneID: 110328984
NCBI-ProteinID: XP_021064165
Ensembl: MGP_PahariEiJ_G0016025
LinkDB
Position
11
AA seq 1091 aa
MAAYSQRRQPSWVVDNKRSRMTPNLPQLLSALTLLHLTMYANGLKKGVQDLKCTTNNMRV
WDCTWPAPLGVSPGTVKDICIKDRFHSCHRLETTNVQIPALSPGDHEVTINYLNGFQSKF
ILNEKDVSLIPETPEILDLSADFFTSSLLLKWNDRGSALPYPSNATWEIKVRQNPRTEPV
ALVSLNAMLSGKDTVHHWNWTSDLPLQCATHSVSIRWHVDYPHFSGYKEWSDWSPLKNIS
WIRNTETNVFPQDKVVLAGSNMTICCMSPTKVLSGQIGNTFRPLIHLYGETVAIHILNIP
VSENSGTNIIFITDDDVYGTVVFAGYPPDVPQKLSCETHDLKEIICSWNPGRITGLVGPR
NTEYTLFESISGKSAVFHRIEGLTDETYWLSLQMHPDQEIHNFTLTGRNPLGQAQSAVVI
NVTERVAPHVPISLKVKNINSTVVTFSWHLPGNFTKINLLCQIEICKANSKKEVRNATIR
GAEDSTYHVAVDKLNPYTTYTFRVRCSSKTFWKWSRWSNEKRHLTTEATPSKGPDTWREW
SSDEKTLIIYWKPLPINEANGKILSYNVSCSLNEETQFSEIFDHQHRAEIQLSKNDYIIS
VVARNSAGSSPPSKIASMEIPNDDIIVEQAVGIGNRIFLTWHHDPNMTCDYVIKWCNSSR
SEPCLLDWIKVPSNSTETVIESDQFQPGVRYNFYLYGCTNQGYQLLRSIIGYVEELAPIV
APNFTVEDTSADSILVKWDDIPVEELRGFLRGYLFYFQKGERDTPKTRSLEPHHSDIKLK
NITDISQKTLRIADLQGKTSYHLVLRAYTHGGLGPEKSMFVVTKENSVGLIIAILIPVAV
AVIVGVVTSILCYRKREWIKETFYPDIPNPENCKALQFQKSVCEGSSALKTLEMNPCTPN
NVEVLESRSIVPKIEDTEIISPVAERPGERSEADPENHVVVSYCPPVIEEEITNPVAEEV
GGASQVVYIDVQSMYQPQAKAEEEQDTDPVVVAGYKPQMRLPINPAVGDTAAEAEADKTA
GYRPQANVNTWNLVSPDSPRSTDSNNEVVSFGSPCSINSRQFLIPPKDEDSPKSNGGGWS
FTNFFQNKPND
NT seq 3276 nt   +upstreamnt  +downstreamnt
atggcagcttactcacagaggagacagccatcttgggtggtagacaataaaagatcgagg
atgactccaaacctgccacagctcctgtcagctctgacccttctgcatctgacaatgtat
gcaaacggtctgaagaaaggggtacaagatttgaaatgcacaaccaacaacatgcgagtg
tgggactgcacgtggccagctcccctcggtgtcagcccaggaactgttaaagacatttgc
attaaagacaggttccattcttgtcaccgattagagacaacaaatgttcaaattccagct
ctttcacctggtgatcacgaagtcacaataaattatctaaatggctttcagagtaaattc
atattgaatgaaaaagatgtctctttaattccagagactcccgagatcttggatctgtct
gctgacttctttacctcctcgttactattgaagtggaacgacagagggtctgctctgcct
tacccctccaatgccacctgggagattaaggtccgacagaacccgaggacggaaccggta
gcgctcgtgtcactcaatgcaatgttgagtggtaaagacacagttcaccactggaactgg
acctcagacctgcccttgcagtgtgccactcactcggtgagcatcagatggcacgttgac
taccctcacttctccggttataaagagtggagtgactggagcccactgaagaacatctcc
tggattcgtaatacggagactaatgttttccctcaagacaaagtggtgctcgcaggctca
aacatgaccatttgttgtatgagtcccacgaaagtgctttcagggcagattggcaatacg
tttcgtcctctcatccatctgtacggggaaactgtggcgatccatatcctgaacataccc
gtttcggaaaacagtggcacaaacatcattttcatcacagatgacgatgtgtacggaacg
gtggtctttgcaggctatcctcccgatgtccctcagaagctgagctgtgagacacacgac
ttaaaagagattatatgtagctggaatccaggaaggataacaggactggtgggcccacga
aatacagagtacaccctgtttgaaagcatttcgggaaaatcggcagtatttcacaggatt
gaaggacttacagatgagacctactggttaagcttgcaaatgcatcccgaccaagaaatc
cataacttcaccctgactggtcgcaatccactgggacaggcacagtcagcagtggtcatc
aatgtgactgagagagttgcccctcatgttccaatttcgttgaaagtgaagaacatcaat
tcaaccgttgttacattttcttggcatttaccaggaaattttacaaagattaatctttta
tgtcaaattgaaatttgtaaagctaattccaagaaagaagtgcggaatgccacaatcaga
ggcgccgaggattcaacttaccatgtcgctgtggacaaattaaacccatacactacatat
actttccgggttcgttgttcttccaagactttctggaagtggagcaggtggagtaatgag
aagcgacatctcaccacagaagccactccttcaaagggaccagatacttggagagagtgg
agttctgatgaaaaaaccctaatcatctactggaagcctttacccattaatgaagctaat
ggaaaaatactttcctacaatgtatcgtgttcactgaatgaggagacacagttttcggag
atctttgatcatcaacacagagcagagatacagcttagtaaaaatgactacatcatcagt
gtggtagcaagaaattctgctggctcatcaccaccttcgaaaatagctagtatggaaatc
ccaaatgatgacatcatagtagagcaagcagtggggataggaaacaggatcttcctcacc
tggcatcacgaccccaacatgacttgtgactacgtaattaaatggtgcaactcgtctcgg
tctgagccctgcctcctggactggataaaggttccttcaaacagcactgagactgtcata
gagtctgatcaatttcagccaggagtaagatacaacttttacctctatgggtgcacaaac
cagggataccaactgttgcgttctataattggatacgtagaagaattggctccgattgtc
gcgccaaatttcaccgtggaagatacgtctgcagactcgatattagtgaaatgggacgac
atccccgtggaagagctccgaggcttcctaagggggtatttattttactttcagaaagga
gagagagatacgcctaagacgaggagcttggagccacatcattctgacatcaagctaaag
aacatcactgacatctcccagaagacgctgaggatcgctgatcttcaggggaagaccagt
taccatctggtcctgcgagcctatacgcacggtggtctaggcccagagaagagcatgttt
gtggtgaccaaggaaaactctgtgggattgattattgccatcctcatcccagtggccgtg
gctgtcattgtaggcgtggtaacgagcatcctttgctatcggaagcgagaatggattaag
gaaacattctacccagatattcccaatccagaaaactgtaaggcgttacagtttcagaag
agcgtctgcgagggaagcagtgctcttaagacattggaaatgaacccctgtaccccgaac
aacgtcgaagtcctggaatctcggtcaatagtccccaaaatagaagatacagaaatcatt
tccccagttgctgagcgtcctggggagagatctgaggcggaccccgagaaccacgtggtc
gtgtcttactgcccacccgtcattgaggaggaaataacgaaccctgtagccgaggaagtg
ggaggggcttcccaggtcgtgtacatcgatgtgcagtccatgtatcagccgcaagccaaa
gcagaggaagagcaggacacggatcctgtggtggtggcaggctataagccacagatgcgc
cttcccattaaccccgccgtgggagacacggcagcagaagctgaagcggacaagaccgct
ggttacagacctcaggccaatgtaaacacttggaatttggtctctccagattccccgagg
tccacagacagcaacaatgaagttgtctcttttggaagtccgtgctccatcaattccagg
caattcttgattcctcctaaagatgaagactctcctaaatccaatggaggagggtggtcc
tttacaaacttcttccagaacaaaccaaacgactaa

KEGG   Mus pahari (shrew mouse): 110329042
Entry
110329042         CDS       T05929                                 

Gene name
Osmr
Definition
(RefSeq) oncostatin-M-specific receptor subunit beta isoform X1
  KO
K05057  oncostatin M receptor
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04151  PI3K-Akt signaling pathway
mpah04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110329042 (Osmr)
   04151 PI3K-Akt signaling pathway
    110329042 (Osmr)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110329042 (Osmr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110329042 (Osmr)
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  IL6/12 receptor family
   110329042 (Osmr)
SSDB
Motif
Pfam: fn3 LIFR_D2 EpoR_lig-bind IL6Ra-bind
Other DBs
NCBI-GeneID: 110329042
NCBI-ProteinID: XP_021064249
Ensembl: MGP_PahariEiJ_G0016024
LinkDB
Position
11
AA seq 974 aa
MAFSVVLHPAFLLTLLSLRASRSEVLEEPLPLTPEIHKASFQLKLQEVNLEWTVPALTHE
ELNMIFQIEISRLNISNIIWVENYSTTVKREEAVRWNWTSDIPLECVTHFIRIRALVDDT
KMSLPQGSWSNWSSWREVNANISVEPDKILLFPKDKLLEEGSNVTICLMYGQNLYNVSCK
LQDQPIHGEQLDSHVSLLKLNNVVFLSDTGANINCRAMKGPKRTFGTVLFVSKVLEEPKN
FSCETQDFKTLDCSWEPGIDTTLAWHKQKFQNYTLCESFSKRCEVSNYRNSYTWQITKDS
QETYNFTLTAENLLRKRSVNINFNLTHRVHPKAPQDVTIKTIGATKANMAWKVRSRGNDY
TLLCQVELQSGGEVIREHNVSVHMSANYLFSDLDPDTKYKAVVRCASANHFWKWSDWTQK
EFSTPEAAPSQALDVWRQMWSENGRRVVTLFWKPLLKSQANGKIISYNIVVENEAKPTAS
EQYSVRAPALSTNLSLDLHPYKIHVTANNNVGASPESLMVLSNDSGHEEVQEKTIKGIKD
AFNISWEPVSGDTMGYVVDWCAHSQDKYCDLQWKNLGPNTTSTIITSDDFKPGIRYNFRI
FERSVEHKARLVEKQRGYTQELAPLVNPKVEIPHLTPNSFVLRWPDYASDFQAGFIKGYH
VYVKSKEMQCNKDWERTLLPDNSVLCKYDISGSETKTLTVGNLQPETLYEFFVTPYTSVG
PGPNETFTKVTTPDARSHMLLQIILPMTLGILLSIIVCYWKSQWVKEKCYPDIPNPYKSS
ILSLIKSKKNPHLIMNVKDCIPDVLEVINKAEGSKTQCVDSWKLHTEDVSTKPPVVPTEK
DASGPVPCIFFENFTYGQSAFDSGSHGLVPGPLKDTAHQLGLLAPPNKFQNILENDYMKS
LVESLTEEETSLIYVSQLASPMCGDKDTHATNPPMPVHGSEYKRQMVVPGSLKLPSLKEN
NSLTSSVLLGQGEQ
NT seq 2925 nt   +upstreamnt  +downstreamnt
atggctttctctgtggtccttcatccagccttcctcctcacactgctgtccctgagggca
tcccgaagcgaagtcttggaggagcctttaccattgactcctgagatacataaagcttct
tttcaattgaaacttcaagaagtgaatttagagtggactgtcccagcccttactcatgaa
gaattaaacatgatatttcagatagagatcagtagactaaacatatccaacatcatctgg
gtggagaattatagtaccactgtgaagcgcgaagaagctgtgcgttggaactggacctct
gatatccctttggagtgtgtcacacatttcataagaataagggctctggtagatgacacc
aagatgtcccttccacagggttcctggagcaactggagttcctggagagaagttaatgca
aacatttccgttgaacctgataaaatattattatttcccaaagacaaactgttggaagaa
ggctccaatgtcaccatctgtctgatgtatgggcagaatctatataatgtatcctgtaag
ttgcaagaccagccaatccatggagaacagcttgattcccacgtgtcgttattaaaattg
aataatgtagttttccttagcgacacaggggcaaacatcaattgtcgagccatgaagggt
cctaaaagaacatttggtactgttctctttgtctcgaaagtgcttgaggaacccaagaat
ttttcctgtgaaacccaagactttaagactttggactgttcatgggaacctgggatagat
acgactttggcttggcataaacaaaaattccaaaactacactttatgtgaatcgttctct
aagagatgtgaggtttctaactacagaaactcctatacctggcaaatcactaaagactca
caggaaacatataactttactctcacagctgaaaacctactaaggaaaagaagtgtcaac
attaattttaacctgacccatagagttcatccaaaggctccgcaggacgtcaccattaaa
actataggtgctacaaaagccaacatggcttggaaggttcgctcccgtggaaacgactac
acacttttgtgtcaggttgaactccaatctggaggagaagtgattcgtgagcacaatgtt
tctgtccacatgagcgcaaactacctcttcagtgatctggatccagacacaaagtacaag
gctgttgtgcgctgtgcaagtgccaaccacttctggaaatggagtgactggacccaaaaa
gagttcagcacgcccgaggctgccccctcacaggctcttgacgtgtggagacaaatgtgg
tctgagaatggaagacgtgttgtgactttattctggaagccactattaaaatcacaggcc
aatggcaaaatcatatcctataatatagttgtagaaaatgaagccaaaccaactgcgtca
gaacagtactctgtccgggcaccagccctcagcaccaacctgagccttgacctgcatcct
tacaagattcacgtcacagccaacaacaacgtgggggcttctcctgagtccttgatggtc
ctttctaatgattctggacatgaagaagtccaggaaaagacaattaaaggtataaaggat
gccttcaatatttcttgggagcccgtatctggagacacgatgggctatgttgtggactgg
tgtgcacattctcaggacaaatactgtgacttgcagtggaagaaccttggtcccaacacc
acaagcaccatcatcacctcagatgattttaaaccagggattcgttacaacttcaggatt
tttgaaaggtctgtggaacacaaagctcggttagtagagaaacaaagaggatacacccag
gaactggctcctttggtgaatccaaaagtggagattcctcacttgacccctaactccttc
gttctaagatggccggattacgccagtgacttccaggctggttttataaaagggtaccac
gtgtatgtgaaatccaaggagatgcagtgcaacaaagactgggaaaggaccctccttcca
gataattcggtcctctgtaaatatgacatcagtggctcagagacaaagacactcaccgtg
ggaaaccttcagccagagaccctctatgagtttttcgtcactccatataccagcgttggc
ccaggacccaatgaaacgttcacaaaggtcacaactccagatgcacgttcccacatgctg
ctgcagatcatactacccatgaccctcggcatcttgctcagcatcattgtctgctactgg
aaaagtcagtgggtgaaggagaagtgctatcctgacattcccaatccatacaagagcagc
atcctgtcactcataaaatccaagaagaaccctcacttaataatgaatgtcaaagactgc
attccagatgtccttgaagtgataaacaaagcagaaggcagcaagacacagtgtgtagac
tcttggaaacttcacactgaagatgtatccaccaagcctccagtcgtgccaacagaaaag
gatgcctcagggcctgtgccctgcatcttctttgagaattttacttatggtcagtcagct
tttgattctggttcccatggcctcgttccaggtcccctaaaagacacagcacaccaactt
ggactattggctccacctaacaagttccagaacatattagaaaatgactacatgaagtcc
ctggtcgaaagtctgactgaagaagaaactagcttgatttatgtgtcgcagctggcttca
cccatgtgcggagacaaggacacacatgccacgaatccacccatgccagtgcatggttca
gagtataaaaggcaaatggtagttccagggagcctcaaattaccttctctgaaggagaat
aacagcttgacctcatcggtcctcttaggccaaggtgaacagtaa

KEGG   Mus pahari (shrew mouse): 110329173
Entry
110329173         CDS       T05929                                 

Gene name
Il7r
Definition
(RefSeq) interleukin-7 receptor subunit alpha
  KO
K05072  interleukin 7 receptor
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04068  FoxO signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04640  Hematopoietic cell lineage
mpah05200  Pathways in cancer
mpah05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110329173 (Il7r)
   04068 FoxO signaling pathway
    110329173 (Il7r)
   04151 PI3K-Akt signaling pathway
    110329173 (Il7r)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110329173 (Il7r)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110329173 (Il7r)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110329173 (Il7r)
  09163 Immune disease
   05340 Primary immunodeficiency
    110329173 (Il7r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110329173 (Il7r)
   04090 CD molecules [BR:mpah04090]
    110329173 (Il7r)
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  IL2 receptor family
   110329173 (Il7r)
CD molecules [BR:mpah04090]
 Proteins
  110329173 (Il7r)
SSDB
Motif
Pfam: FN3_7 fn3
Other DBs
NCBI-GeneID: 110329173
NCBI-ProteinID: XP_021064434
Ensembl: MGP_PahariEiJ_G0016039
LinkDB
Position
11
AA seq 457 aa
MIALGRAFAMVFCLIQAVSGESGNAQDGDLEDAEPDDHSFWCYSQLEVDGSQHLLTCAFN
DSDINTTNLEFQICGALLRVKCLTLNKQQDIYFIKTTEFLLIGSSDICVKLGQKNLACKS
MAINTIVKAEAPSDLKVIYRKEANDFLVTFSAPHLKKKYLKQVKHDMAYRPARGESNWTH
VSLFHMRTTIPQRKLWPKTVYEIKVRSIPHNDYFKGFWSEWSPSSTFETPEPKNQGGWDP
VLPTVTILSLFSVLLLVILAHVLWKKRIKPVVWPSLPDHKKTLEQLCKKPKKNLNVSFNP
ESFLDCQIHEVNGIEARDEVEHFLPNDLPPQPEELEKQGPRTAVHSANRASETSVSPPET
FRRESPLRCLARNLSSCNTPPLLSSRSPDNRDGDGNRPPVYQDLLPSSANTNDPVPQPLP
LQLGILIPVSQRQPISTSSVLNQEEAYVTMSSFYQNK
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgatagctctgggtagagctttcgctatggttttctgcttaattcaagctgtttctgga
gaaagtggcaatgcccaggatggagacctagaagacgcagaaccggacgatcactccttc
tggtgctacagccagttggaagtggatggaagtcaacatttattgacttgtgcttttaat
gactcagacatcaacacaactaatctggaatttcaaatatgtggggctcttttacgtgtg
aaatgcctaactcttaacaagcagcaagatatatattttataaagacaacagaattctta
ctgattggtagcagcgatatatgtgtgaagcttggacaaaagaatttagcttgcaaaagt
atggctataaacacaatagttaaagctgaggctccttctgacctgaaagtcatttatcga
aaagaagcaaatgactttttggtgacatttagtgcacctcacttgaaaaagaaatattta
aaacaagtgaagcatgacatggcctaccgcccagcaaggggtgaaagtaactggacgcat
gtatctttattccacatgagaacaacaatcccacagagaaagctatggccaaaaacagtg
tatgaaatcaaagtccgatccattccccataatgattacttcaaaggcttctggagcgag
tggagtccaagttctaccttcgaaactccagaacccaagaatcaaggaggatgggatcct
gttttgccaactgtcaccattctgagtttgttctctgtgcttttgttggtcatcttagcc
catgtgctatggaaaaaaaggattaaacctgtcgtatggcctagtctccctgatcataag
aaaactctggaacaactatgtaagaagccaaaaaagaatctgaatgtgagtttcaatcct
gaaagtttcctggactgccagattcatgaggtgaatggcattgaagccagggatgaggtt
gaacattttctgccaaatgatcttcctccacagcctgaggagctggagaagcagggaccc
agaacagctgtacacagtgcaaaccgggcatctgagacttcagtcagcccgccagaaaca
ttcagaagagagtcccccttaagatgcctggctagaaatctgagttcatgcaatacccct
ccactcctttcctctaggtcccctgacaacagagatggtgacggaaataggcctcctgtg
tatcaagacttgctgccaagctctgcaaacacaaatgatcctgtccctcaaccattgcct
ctccagttgggaatcctgataccagtttctcagagacagcccatctccacttcctcagtc
ctgaatcaagaagaagcatatgtcactatgtctagtttttaccaaaacaaatga

KEGG   Mus pahari (shrew mouse): 110329735
Entry
110329735         CDS       T05929                                 

Gene name
Ifnar2
Definition
(RefSeq) interferon alpha/beta receptor 2
  KO
K05131  interferon receptor 2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04151  PI3K-Akt signaling pathway
mpah04217  Necroptosis
mpah04380  Osteoclast differentiation
mpah04620  Toll-like receptor signaling pathway
mpah04621  NOD-like receptor signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah05160  Hepatitis C
mpah05162  Measles
mpah05164  Influenza A
mpah05165  Human papillomavirus infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05171  Coronavirus disease - COVID-19
mpah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110329735 (Ifnar2)
   04151 PI3K-Akt signaling pathway
    110329735 (Ifnar2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110329735 (Ifnar2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110329735 (Ifnar2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110329735 (Ifnar2)
   04621 NOD-like receptor signaling pathway
    110329735 (Ifnar2)
   04650 Natural killer cell mediated cytotoxicity
    110329735 (Ifnar2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110329735 (Ifnar2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110329735 (Ifnar2)
  09172 Infectious disease: viral
   05160 Hepatitis C
    110329735 (Ifnar2)
   05171 Coronavirus disease - COVID-19
    110329735 (Ifnar2)
   05164 Influenza A
    110329735 (Ifnar2)
   05162 Measles
    110329735 (Ifnar2)
   05168 Herpes simplex virus 1 infection
    110329735 (Ifnar2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110329735 (Ifnar2)
   05169 Epstein-Barr virus infection
    110329735 (Ifnar2)
   05165 Human papillomavirus infection
    110329735 (Ifnar2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110329735 (Ifnar2)
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  IFN receptor family
   110329735 (Ifnar2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 110329735
NCBI-ProteinID: XP_021065228
Ensembl: MGP_PahariEiJ_G0016662
LinkDB
Position
12
AA seq 512 aa
MRSRCAISAVGFLCLCLVVCESLETISPSAFDGYPDEPCTINMTIRNFRLILSWELENKS
SPPANFTLWYTVMSKNEDLMKVKNCSDTTKSSCDVTAEWLEGMESYVAIVLVHRGDLTVC
RCSDYIVPANAPLKPPEFEIIGFTDHINVTMEFPPVTSKIIREKMRSTPFVIKEQIGDSI
RKQHKPKVNNVTGNFTFVLKDLLPKTNYCVSVYFDDDPAIKSPLKCIVLQPDQESGLSES
AKVGIITSGLIVMFFVSTIIMLKRIGYICLKDNLPNVLNFHHFLTWIFPERSPSEAIDRL
EIIPTNKKKRLWNYDYEDGSDSDEEVPTASVTGYTMHGLTGKPLPQSSDTSASPEDPLHE
EDSGAEESDEAGVGAGAEPQLLTEAGVGPSEDPSGPSERRKSVLKDSFPSEDNSSMDEPG
DNTIFNVNLNSVFLRVLHDKDASETLSLAEDAILLDEGPHRTESDLRIAGEDRTQPSLPS
LPSQDLWTEDGSSEKSDTSDSDADVGDGYIMR
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgcgttcacggtgcgccatctctgctgttggtttcctctgcttgtgtcttgtggtgtgt
gagagcctagagactatctcaccgtcggcctttgatgggtatccagatgaaccttgcact
ataaatatgacaatacggaatttccggctaattttatcctgggaattagaaaacaagtcc
agcccacccgctaacttcacactctggtacacggtcatgagcaaaaacgaagatctgatg
aaggttaagaactgttcagataccacgaagtcatcatgtgacgtgacagcggagtggctg
gagggcatggagagctacgtcgccatcgtcttagtgcacagaggagacttgactgtgtgt
cgatgttcagactacatcgtgcctgcaaacgctcctcttaagccaccagaatttgagatc
attggctttacagaccacataaacgtgacgatggaatttccacctgtcacttccaagata
atccgggaaaagatgaggtctacaccatttgtcatcaaagagcagataggggacagcatc
aggaagcagcacaagcccaaggtgaataatgtcactgggaacttcacatttgtccttaaa
gacttacttccaaagacaaactactgtgtatctgtttattttgatgatgaccccgcaata
aaatctcccttaaaatgcatcgtccttcagcctgaccaggaatcaggattatcagaatct
gccaaagtaggaataattacttcgggtttgatagtgatgttttttgtgagcaccatcata
atgctgaaacgaattggctatatatgcctaaaagacaatttgcccaatgtcttgaacttc
catcactttctaacctggatattccctgaacggtcaccttcagaagccatcgaccggctg
gaaatcatccccacaaacaagaagaagagactgtggaattacgattatgaggatggcagt
gacagtgatgaagaggtccccacagcaagtgtcactggctacaccatgcatggactgacg
ggcaagcctctgcctcagagctctgacacctccgccagccccgaggatcccctgcatgaa
gaagactcaggtgctgaggaatctgatgaagctggagtgggtgctggagctgagccacag
ctcctcacagaggcgggggtggggccttcagaagacccaagtggccccagtgagagaaga
aagagtgtgctcaaggactccttcccctcggaggacaacagctccatggatgagcccggg
gacaacactatcttcaacgttaacttaaactctgtgtttttgagagttctccatgataaa
gatgcctcggagacgttatctctcgcagaagacgccatcctcctagacgaaggtccccac
aggacagagtcagaccttcggatagctggtgaggacaggacacagccatccctccccagc
cttccttcccaggatctatggactgaagatgggtcatctgagaaatcagacacctcggat
tccgatgctgatgtgggggacggctacatcatgagatga

KEGG   Mus pahari (shrew mouse): 110329827
Entry
110329827         CDS       T05929                                 

Gene name
Ifnar1
Definition
(RefSeq) interferon alpha/beta receptor 1
  KO
K05130  interferon receptor 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04151  PI3K-Akt signaling pathway
mpah04217  Necroptosis
mpah04380  Osteoclast differentiation
mpah04620  Toll-like receptor signaling pathway
mpah04621  NOD-like receptor signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05162  Measles
mpah05164  Influenza A
mpah05165  Human papillomavirus infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05171  Coronavirus disease - COVID-19
mpah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110329827 (Ifnar1)
   04151 PI3K-Akt signaling pathway
    110329827 (Ifnar1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110329827 (Ifnar1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110329827 (Ifnar1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110329827 (Ifnar1)
   04621 NOD-like receptor signaling pathway
    110329827 (Ifnar1)
   04650 Natural killer cell mediated cytotoxicity
    110329827 (Ifnar1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110329827 (Ifnar1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110329827 (Ifnar1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    110329827 (Ifnar1)
   05160 Hepatitis C
    110329827 (Ifnar1)
   05171 Coronavirus disease - COVID-19
    110329827 (Ifnar1)
   05164 Influenza A
    110329827 (Ifnar1)
   05162 Measles
    110329827 (Ifnar1)
   05168 Herpes simplex virus 1 infection
    110329827 (Ifnar1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110329827 (Ifnar1)
   05169 Epstein-Barr virus infection
    110329827 (Ifnar1)
   05165 Human papillomavirus infection
    110329827 (Ifnar1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110329827 (Ifnar1)
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  IFN receptor family
   110329827 (Ifnar1)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3
Other DBs
NCBI-GeneID: 110329827
NCBI-ProteinID: XP_021065375
Ensembl: MGP_PahariEiJ_G0016665
LinkDB
Position
12
AA seq 588 aa
MLSVVGAAALVLVAGAPWVLPSAAGGENLKPPENIDVYIIDDNYTLKWSSHRESVGNVTF
SAEYRTKDEAKWFKVPECQHTTRTKCEFSLLDTNVYIKTQFRVRAEEGNSTSSWNEVDPF
IPFYTAHISPPEVRLEAEDKAILVHISPPGQDGNMWTLEKPSFSYTIQIWQKSSSDKKTI
NSTYYPEKIPELLPETTYCLEVEAIHQSLKKHSNYSAVQCISTTVANKMPVPGNLEVDAQ
GESYVLKWDYIASADVSFRAQWLPGYSKSSSGSRSDKWKPIPTCANVWTTHCVFTRDTVY
TGTFFLRVQASDENNTSFWSEEKFIDSQIYILLPPPVITVTPTRDTLLVYVNCQDSFSKC
DRLTYEIIFWEDTSNPKKSHREFTLKNLQPLTVYCVQARVLSTALQNKTSNFSDKLCEKT
RPGSFSMIWIIIGFGAVLFSVVVLYALKSVWKRLCHVCFPPLKPPRSIDEFFSEPPSKNL
VLLTPEEHTERCFIIENADMVAVEEEHAPEEDLRKYSSQTSQDSGNYSNEEEESGGPESS
QTVLSTALCGSPWTVPGPPGTLEDGTCFLGNEKHLQSPALRTEPALLC
NT seq 1767 nt   +upstreamnt  +downstreamnt
atgctctctgtcgtgggcgcggcggccctggtgctggtggccggggcgccttgggtgcta
ccctcagctgcaggtggagaaaatctgaaacctcctgagaatatagacgtctacattata
gatgacaactataccctaaagtggagcagccacagagagtcagtgggcaatgtgacgttt
tcagcagaatatcgaacaaaagacgaggcgaagtggttcaaagtgcctgaatgtcaacat
actacaaggaccaaatgtgaattctctttactggacacaaatgtgtatatcaaaacacag
tttcgtgtcagagcagaggaagggaacagcacgtcttcatggaatgaggttgatccattt
attccattctacacagctcatatcagccccccagaagtacgcttagaagctgaagataaa
gccatactggtccacatctctcctcctggacaagacggcaacatgtggacactggagaaa
ccttccttcagttacaccatacaaatctggcagaagtcttccagtgacaaaaaaactatt
aactctacgtattatccagaaaagataccagagctcttgccagagaccacttactgttta
gaagttgaagcaatacatcagtcactaaagaaacacagcaattacagcgcagtgcagtgt
ataagcaccacagtggcaaataaaatgcctgtgccaggaaatctagaagtggatgcccaa
ggcgagagctatgttctgaaatgggactacattgcgtctgcagacgtgagcttcagagca
cagtggctccctggctattcaaaaagcagttctggaagccgttcagataaatggaagcca
attccaacctgtgcaaatgtctggactacacactgtgtctttactcgggatactgtctac
acaggaacgttctttctccgtgtacaagcctcagatgaaaataacacatccttttggtct
gaagagaagtttattgattctcaaatatacattctccttcctcctccggtcattactgtc
acccccacgagggacaccttgcttgtttatgtcaactgtcaggacagtttcagcaaatgt
gatagactcacttacgaaatcatcttttgggaagacacttccaatcctaaaaagagtcac
cgggaattcaccctcaaaaacctgcagccgctgactgtgtactgtgtccaggccagagtg
ctctccacagccctgcagaataagaccagcaacttcagtgataagctgtgtgagaaaaca
cgtccaggaagtttttccatgatctggattatcattggatttggtgctgtgttgttctct
gtcgtggtgctttatgctttgaagagcgtctggaaacgcctgtgtcatgtgtgcttccca
ccactcaagcctccccgcagtattgatgaatttttctctgagccgccttcaaaaaacctt
gtacttctgacgcctgaggagcacaccgaaagatgcttcatcattgagaacgcagacatg
gtcgctgtagaggaagagcatgcacctgaggaagatctcaggaagtacagttcccagacc
agccaggactcggggaactattctaatgaagaggaggaaagtgggggccctgaaagcagc
caaacagtgctctccacagctctctgtgggagtccgtggacagtgcctggccctcctggg
accttggaagacgggacctgcttcctggggaatgaaaagcatcttcagagcccagccctg
aggacagagccagctctcctctgctga

KEGG   Mus pahari (shrew mouse): 110329837
Entry
110329837         CDS       T05929                                 

Gene name
Il10rb
Definition
(RefSeq) interleukin-10 receptor subunit beta
  KO
K05135  interleukin 10 receptor beta
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04061  Viral protein interaction with cytokine and cytokine receptor
mpah04630  JAK-STAT signaling pathway
mpah05145  Toxoplasmosis
mpah05152  Tuberculosis
mpah05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110329837 (Il10rb)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110329837 (Il10rb)
   04061 Viral protein interaction with cytokine and cytokine receptor
    110329837 (Il10rb)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110329837 (Il10rb)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    110329837 (Il10rb)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110329837 (Il10rb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110329837 (Il10rb)
   04090 CD molecules [BR:mpah04090]
    110329837 (Il10rb)
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  IL10/28 receptor family
   110329837 (Il10rb)
CD molecules [BR:mpah04090]
 Proteins
  110329837 (Il10rb)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3 TMEM251 zf-MIZ
Other DBs
NCBI-GeneID: 110329837
NCBI-ProteinID: XP_021065389
Ensembl: MGP_PahariEiJ_G0016664
LinkDB
Position
12
AA seq 362 aa
MAWAPSVASWLGGFLLVPALGMIPPPENVRMNSVNFKNILQWEVPAFPRKNLTFTAQYES
YRSFQDRCTNTASTQCDFSILSKYGDHTVRVRAESADEHSEWVNVTFCPVEDTIIGPPEM
QIESLADSLHMRFSAPQIENEPETWTLKNIYDSWAYRVQYWKNGTNEKFQVMSPYDSEVL
RDLEPWTTYCIQVQGFLLDQNRTGEWSEPICERTSNDETTPSWIMAIILIVSVLVVFLFL
LGCFGILWFIYKKTKCTFRSGTSFPQHLKEFLGHPHHSTFLLFSFPPPEEAEVFDKLSII
TEESKGSKQSPEDNHASEPPSEPGPRELESKDEPPSPPHDAPELLTSTSEVRPESHLRKL
QI
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggcctgggcgccgagcgtggcgagctggctgggtggcttcctcctggtgccagctcta
ggaatgattccaccccctgagaatgtcagaatgaattcagttaatttcaagaacattcta
cagtgggaggtacctgctttccccagaaagaacctgactttcacagctcagtatgaaagt
tacaggtctttccaagatcgctgcacgaacactgcctctactcagtgcgacttctctatt
ctttctaaatatggagaccacaccgtgagagtcagggctgagtctgcagatgaacattcg
gagtgggtaaatgtcaccttctgccctgtggaagacaccattattggacctcctgagatg
cagatagaatcccttgctgattctttacacatgcgtttctcagccccacaaattgagaat
gagcctgagacatggaccttgaagaacatttatgactcatgggcttatagggtgcaatac
tggaaaaacgggactaatgagaagttccaagtcatgtctccgtacgactctgaggtcctc
cgggacctggagccgtggacaacttactgcattcaagttcaagggtttcttctcgaccag
aacagaacaggagagtggagcgaacccatctgtgaacggacaagcaatgacgaaacaacc
ccttcctggattatggccatcatcctcatagtctccgtcctggtggtcttcctcttcctc
ctgggctgctttggcatactgtggttcatttataagaagaccaagtgcaccttccgttct
gggacgtcttttccacagcacctgaaggagtttctgggccacccccatcacagcacgttt
ctgctcttctccttccctccccctgaggaggccgaggtgttcgacaagctaagcatcatc
acggaggagtctaaaggcagcaagcagagtcctgaagacaaccatgcctcagagcccccg
tctgagccagggcctcgggagctggagtccaaggatgaacctccctcacctccacacgat
gcccccgaactgctcacatcaacctcagaagtacgaccagagagccacctgagaaaactc
caaatctag

KEGG   Mus pahari (shrew mouse): 110330069
Entry
110330069         CDS       T05929                                 

Gene name
Ifngr2
Definition
(RefSeq) interferon gamma receptor 2
  KO
K05133  interferon gamma receptor 2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04066  HIF-1 signaling pathway
mpah04217  Necroptosis
mpah04380  Osteoclast differentiation
mpah04630  JAK-STAT signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah05140  Leishmaniasis
mpah05142  Chagas disease
mpah05145  Toxoplasmosis
mpah05152  Tuberculosis
mpah05164  Influenza A
mpah05168  Herpes simplex virus 1 infection
mpah05200  Pathways in cancer
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mpah05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110330069 (Ifngr2)
   04066 HIF-1 signaling pathway
    110330069 (Ifngr2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110330069 (Ifngr2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110330069 (Ifngr2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110330069 (Ifngr2)
   04658 Th1 and Th2 cell differentiation
    110330069 (Ifngr2)
   04659 Th17 cell differentiation
    110330069 (Ifngr2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110330069 (Ifngr2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110330069 (Ifngr2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110330069 (Ifngr2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    110330069 (Ifngr2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110330069 (Ifngr2)
  09172 Infectious disease: viral
   05164 Influenza A
    110330069 (Ifngr2)
   05168 Herpes simplex virus 1 infection
    110330069 (Ifngr2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110330069 (Ifngr2)
   05140 Leishmaniasis
    110330069 (Ifngr2)
   05142 Chagas disease
    110330069 (Ifngr2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110330069 (Ifngr2)
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  IFN receptor family
   110330069 (Ifngr2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 110330069
NCBI-ProteinID: XP_021065673
Ensembl: MGP_PahariEiJ_G0016666
LinkDB
Position
12
AA seq 330 aa
MRPLPLWLLSLLLCGLGAAASSPDSSSQLSAPQNPKLHLYNDEQTLTWEPSPSSDDTRPV
VYQVEYSYIDGSWYRLLRPNCTDITETKCDLTGGGRLKIFPHSFKVFLRVRAKRENLTSE
WVRLEPFQHYENVTVGPPKNISVTPGKGSLIIHFSPPFDVFHGATFQYLVHYWEKSGTRQ
VEGPFKSNSIVLGNLKPFRVYCLQTEAQLILKNKNIQPHGLLSNVSCHETTADASTRLQQ
VTLIPLGIFTLLLVLTGACFILFLKYQSRVKYWFQAPPNIPEQIKEYLKDPDQFILEALD
KDSSPKEDSWDSVSIISSPEKERDDVLHTP
NT seq 993 nt   +upstreamnt  +downstreamnt
atgcggcctctgccactgtggctgctgtcgctgctgctctgtgggctcggcgccgcggcg
tcctcgccagactcctcttcccagctctcggcccctcagaacccaaagcttcacctgtac
aatgacgagcagactctaacttgggagccgtcaccttccagcgatgacacgaggccagtg
gtctaccaggtggaatatagctacatcgatggctcttggtataggttgctgaggccgaac
tgtacggacatcacagagacgaagtgtgacctcacaggaggcggccgtttgaagattttc
ccacactcattcaaagtcttcctgcgggtgcgagccaagcgagaaaacctcacttccgag
tgggtgaggctggagccgtttcaacactatgagaatgttactgttggacctccgaaaaac
atctcggtgaccccaggaaaaggctccctcatcatacacttctcccctccttttgatgtg
ttccatggggcaacttttcagtatcttgtccactactgggaaaagtcaggaacccgacag
gttgaaggccctttcaagagcaattccattgtgctgggtaatctgaagccattcagagtg
tattgtttacaaactgaggcgcaactgattttgaaaaacaaaaatatccaaccacacggg
ctcttgagcaatgtatcctgtcatgaaacaacagcagatgcctccaccaggctgcagcaa
gtcaccctgattcctttgggcatcttcacattgctgctggtgctgacgggagcctgcttc
atcctgttcctcaaataccaaagccgggtgaagtactggtttcaagctccaccaaacatc
ccagaacaaatcaaagagtatctaaaggacccagatcaattcatcttggaggccttggac
aaggacagttcaccgaaggaggattcctgggactccgtgtcaatcatttcttctccagaa
aaggagcgagatgatgtgctccatacaccgtga

KEGG   Mus pahari (shrew mouse): 110330480
Entry
110330480         CDS       T05929                                 

Gene name
Egfr
Definition
(RefSeq) epidermal growth factor receptor isoform X1
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah01522  Endocrine resistance
mpah04010  MAPK signaling pathway
mpah04012  ErbB signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04020  Calcium signaling pathway
mpah04066  HIF-1 signaling pathway
mpah04068  FoxO signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04144  Endocytosis
mpah04151  PI3K-Akt signaling pathway
mpah04510  Focal adhesion
mpah04520  Adherens junction
mpah04540  Gap junction
mpah04630  JAK-STAT signaling pathway
mpah04810  Regulation of actin cytoskeleton
mpah04912  GnRH signaling pathway
mpah04915  Estrogen signaling pathway
mpah04921  Oxytocin signaling pathway
mpah04926  Relaxin signaling pathway
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04934  Cushing syndrome
mpah05160  Hepatitis C
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05171  Coronavirus disease - COVID-19
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05206  MicroRNAs in cancer
mpah05210  Colorectal cancer
mpah05212  Pancreatic cancer
mpah05213  Endometrial cancer
mpah05214  Glioma
mpah05215  Prostate cancer
mpah05218  Melanoma
mpah05219  Bladder cancer
mpah05223  Non-small cell lung cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05230  Central carbon metabolism in cancer
mpah05231  Choline metabolism in cancer
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110330480 (Egfr)
   04012 ErbB signaling pathway
    110330480 (Egfr)
   04014 Ras signaling pathway
    110330480 (Egfr)
   04015 Rap1 signaling pathway
    110330480 (Egfr)
   04630 JAK-STAT signaling pathway
    110330480 (Egfr)
   04066 HIF-1 signaling pathway
    110330480 (Egfr)
   04068 FoxO signaling pathway
    110330480 (Egfr)
   04020 Calcium signaling pathway
    110330480 (Egfr)
   04072 Phospholipase D signaling pathway
    110330480 (Egfr)
   04151 PI3K-Akt signaling pathway
    110330480 (Egfr)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110330480 (Egfr)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110330480 (Egfr)
   04520 Adherens junction
    110330480 (Egfr)
   04540 Gap junction
    110330480 (Egfr)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110330480 (Egfr)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    110330480 (Egfr)
   04915 Estrogen signaling pathway
    110330480 (Egfr)
   04921 Oxytocin signaling pathway
    110330480 (Egfr)
   04926 Relaxin signaling pathway
    110330480 (Egfr)
   04928 Parathyroid hormone synthesis, secretion and action
    110330480 (Egfr)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110330480 (Egfr)
   05206 MicroRNAs in cancer
    110330480 (Egfr)
   05205 Proteoglycans in cancer
    110330480 (Egfr)
   05230 Central carbon metabolism in cancer
    110330480 (Egfr)
   05231 Choline metabolism in cancer
    110330480 (Egfr)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110330480 (Egfr)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110330480 (Egfr)
   05212 Pancreatic cancer
    110330480 (Egfr)
   05225 Hepatocellular carcinoma
    110330480 (Egfr)
   05226 Gastric cancer
    110330480 (Egfr)
   05214 Glioma
    110330480 (Egfr)
   05218 Melanoma
    110330480 (Egfr)
   05219 Bladder cancer
    110330480 (Egfr)
   05215 Prostate cancer
    110330480 (Egfr)
   05213 Endometrial cancer
    110330480 (Egfr)
   05224 Breast cancer
    110330480 (Egfr)
   05223 Non-small cell lung cancer
    110330480 (Egfr)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110330480 (Egfr)
  09172 Infectious disease: viral
   05160 Hepatitis C
    110330480 (Egfr)
   05171 Coronavirus disease - COVID-19
    110330480 (Egfr)
   05163 Human cytomegalovirus infection
    110330480 (Egfr)
   05165 Human papillomavirus infection
    110330480 (Egfr)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110330480 (Egfr)
   01522 Endocrine resistance
    110330480 (Egfr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110330480 (Egfr)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110330480 (Egfr)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110330480 (Egfr)
Protein kinases [BR:mpah01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   110330480 (Egfr)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   110330480 (Egfr)
  Exosomal proteins of pancreatic cancer cells
   110330480 (Egfr)
  Exosomal proteins of bladder cancer cells
   110330480 (Egfr)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like
Other DBs
NCBI-GeneID: 110330480
NCBI-ProteinID: XP_021066267
Ensembl: MGP_PahariEiJ_G0016788
LinkDB
Position
13
AA seq 1210 aa
MRPSGTTRTTLLVLLTALCAAGGALEEKKVCQGTSNRLTQLGTFEDHFLSLQRMYNNCEV
VLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNALYENTYALA
ILSNYGTNRTGLRELPMRNLQEILIGAVRFSNNPILCNMETIQWRDIVQNVFLSNMSMDL
QSHPSSCPKCDPSCPNGSCWGGGEENCQKLTKIICAQQCSRRCRGRSPSDCCHNQCAAGC
TGPRESDCLVCQKFRDEATCKDTCPPLMLYNPTTYQMDINPEGKYSFGATCVKKCPRNYV
VTDHGSCVRACGPDYYEVEEDGLRKCKKCDGPCRKVCNGIGIGEFKDTLSINATNIKHFK
YCTAISGDIHILPVAFKGDSFTRTPPLDPRELEILKTVKEITGFLLIQAWPENWTDLHAF
ENLEIIRGRTKQHGQFSLAVVGLNITTLGLRSLKEISDGDVIISANRNLCYANTINWKKL
FGTPNQKTKIVSNRAEKDCKAMNHVCNPLCSSEGCWGPEPRDCVSCQNVSRGRECVDKCN
ILEGEPREFVENSECIQCHPECLPQTMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGIM
GENNTLVWKYADANNVCHLCHVNCTYGCSGPGLQGCEVWPSGPKIPSIATGIVGGLLFIV
VVALGIGLFIRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQAHLRILKETEFKKIKVL
GSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLL
GICLTSTVQLITQLMPYGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDL
AARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVW
SYGVTVWELMTFGSKPYDGIPASDISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSR
PKFRELILEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMEDVVDADEYLI
PQQGFFNSPSTSRTPLLSSLSATSNNSTVACINRNGSCRVKEDTFLQRYSSDPTGVVTED
NIDDAFLPAPEYINQSVPKRPAGSVQNPVYHNQPLHPAPGRDLHYQNPHSNAVGNPEYLN
TAQPTCLSSGFNSPAFWIQKDSHQMNLDNPDYQQDFSPKEAKPNGIFKGPTAENAEYLRV
APPSSEFIGA
NT seq 3633 nt   +upstreamnt  +downstreamnt
atgcgaccctcggggaccacgagaaccacgttgctggtgctgctgaccgcgctctgcgcc
gcaggtggggcgctggaggaaaagaaagtctgccaaggcacaagtaacaggctcacccaa
ctgggcacttttgaagaccactttctgagcctgcagaggatgtacaacaactgtgaagtg
gtccttgggaacttggaaattacctatgtgcaaaggaattatgacctttccttcttaaag
accatccaggaggtggctggctatgtcctcatcgccctcaacaccgtggagagaatccct
ttggagaacctgcagatcatcaggggaaatgctctctatgaaaacacctatgccttagcc
atcctgtccaactacgggacaaacagaactgggcttagggaactgcccatgcggaactta
caggaaatcctgattggtgctgtgcgattcagcaacaaccccatcctctgcaatatggag
actatccagtggagggacatcgtccaaaatgtctttctgagcaacatgtcaatggactta
cagagccacccgagcagttgccccaaatgtgatccaagctgtcccaatggaagctgctgg
ggcggaggagaagagaactgccagaaattgaccaaaatcatctgtgcccagcaatgttcc
cggcgttgtcgtggcaggtcccccagtgactgctgccacaaccagtgtgccgcggggtgt
acgggaccccgagagagtgactgtctggtctgccaaaagttccgagatgaggccacatgc
aaagacacctgcccaccactcatgctgtacaaccctaccacatatcagatggatatcaac
cctgaagggaagtacagctttggtgccacctgtgtgaagaagtgtccccgaaactatgtg
gtgacagatcatggctcatgtgtccgggcctgtgggcctgactactacgaagtggaagaa
gatggcctccgaaagtgtaaaaaatgtgatgggccctgtcgcaaagtttgtaatggcata
ggcattggtgaatttaaagacacgctctccataaatgctacaaatatcaaacacttcaaa
tactgcactgccatcagcggggacattcacatcctgccagtggcctttaagggggattct
ttcacgcgcactcctcctctagacccacgagaactagaaatcctaaaaaccgtaaaggaa
ataacagggtttttgctgattcaggcttggcctgaaaactggactgacctccatgctttt
gagaacctagaaattatacgtggcagaacaaagcaacatggtcagttttctctggcggtt
gtcggcctgaacatcacaacactggggttgcgttccctcaaggagatcagtgatggggat
gtgatcatttctgcaaaccgaaatttgtgctacgcaaacacaataaactggaaaaaactc
ttcgggacacccaatcagaaaaccaaaatcgtgagcaacagagctgagaaagactgcaag
gccatgaaccacgtctgcaatcctttatgctcctccgaaggctgctggggccctgagccg
agggactgtgtctcctgccagaatgtgagcagaggcagggagtgcgtggataaatgcaac
atcctggagggggagccgagggagtttgtggaaaattcggaatgcatccagtgccatcca
gaatgtctgccccagaccatgaacatcacctgtacaggcagggggccagacaactgcatc
cagtgtgcccactatattgatggcccacactgtgtcaagacctgcccagctggcatcatg
ggggagaacaacaccctggtctggaagtatgcagatgccaataatgtctgccacctctgc
catgtcaactgtacctatggatgttctgggccaggtcttcaaggatgtgaagtatggcca
tctgggccaaagatcccatctatcgccactgggattgtgggtggcctcctcttcatagtg
gtggtggcccttgggattggcctattcatccgaaggcgtcacattgtccgaaagcgtaca
ctacgccgcctgcttcaagagagagagctcgtggaacctctcacacccagcggagaagct
ccaaaccaagcccacttgaggatattaaaggaaacagaattcaaaaagatcaaagttctg
ggttcaggagcatttggcacagtgtataagggtctctggatcccagaaggtgagaaagta
aaaatcccggtggccatcaaggagttaagagaagccacatctccaaaagccaacaaggaa
atccttgacgaagcctatgtgatggctagtgtggacaaccctcatgtgtgccgcctcctg
ggcatctgtctgacctccaccgtccagctcatcacacagctcatgccctatggttgcctc
ctggactatgtccgagaacacaaggacaacattggctcccagtacctactcaactggtgt
gtgcagattgcaaagggcatgaactacctggaagatcggcgtttggtgcaccgtgacttg
gcagccaggaatgtactggtgaagacaccacagcatgtcaagatcacagattttgggctg
gccaaactgctcggtgctgaagagaaagaatatcacgcagaggggggcaaagtgcctatc
aagtggatggctttggaatcaattttacaccgaatttatacacaccaaagcgatgtctgg
agttatggagtcaccgtgtgggaactgatgacctttgggtccaagccttatgatggaatc
cccgcaagtgacatctcatccatcctagagaaaggagagcgccttccacagccacctatc
tgcaccattgatgtctacatgatcatggtcaagtgctggatgatagatgctgatagccgc
ccaaagttccgcgagttgattcttgaattctccaaaatggcccgagacccacaacgctac
cttgttatccagggggatgaaagaatgcatttgccaagcccgacagactccaacttttac
cgagccctgatggatgaagaggacatggaggatgtagttgatgctgatgagtatcttatc
ccacagcaaggcttcttcaacagcccatccacatcgaggactcccctcttgagttctctg
agtgcaactagcaacaattccacagtggcttgcattaatagaaatgggagctgccgtgtc
aaagaagacaccttcttgcagcggtacagctccgaccccacaggcgttgtaacagaggac
aacatagatgacgcattcctccctgcacctgaatatataaaccaatctgttcccaagagg
ccagcaggctctgtacagaaccccgtctatcacaatcagcccctgcatccagctcctgga
agagacctgcattatcaaaatccccatagcaatgcagtgggcaaccctgagtatctcaac
actgcccagcctacctgtctcagtagtgggtttaacagccctgcattctggatccagaaa
gacagccaccaaatgaacctagacaaccctgactaccagcaggacttctcccccaaggaa
gccaagccaaatggcatctttaagggccccacagcggaaaatgcagagtacctacgggtg
gcacctccaagcagcgagtttattggagcatga

KEGG   Mus pahari (shrew mouse): 110331013
Entry
110331013         CDS       T05929                                 

Gene name
Il21r
Definition
(RefSeq) interleukin-21 receptor
  KO
K05075  interleukin 21 receptor
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04630  JAK-STAT signaling pathway
mpah04659  Th17 cell differentiation
mpah05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110331013 (Il21r)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110331013 (Il21r)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    110331013 (Il21r)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    110331013 (Il21r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110331013 (Il21r)
   04090 CD molecules [BR:mpah04090]
    110331013 (Il21r)
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  IL2 receptor family
   110331013 (Il21r)
CD molecules [BR:mpah04090]
 Proteins
  110331013 (Il21r)
SSDB
Motif
Pfam: IL4Ra_N EpoR_lig-bind
Other DBs
NCBI-GeneID: 110331013
NCBI-ProteinID: XP_021066990
Ensembl: MGP_PahariEiJ_G0013645
LinkDB
Position
1
AA seq 529 aa
MPRGLVPALLLLILHGAWSCLDLTCYTDYLWTITCVLETRSPSPSILSLTWQDEYEELQD
QETSCSLHRSGHNTTHRWYTCHMRLSQFLSDEVFVVNVTDQSGNNSRECGSFVLAESIKP
AAPLNVTVTFSGRYDISWDSAYDEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDS
RNVSLLPEEFHKDSSYQLQVRAAPQPGTSFRGTWSEWSDPVIFQTQAEEPEAGWDPHMLL
LLAVLIIVLVFMGLKIHLPWRLWKKVWAPVPTPESFFQPLYREHSGNFKNWVNTPFTASS
VELMPQSSTTTSALHLSSHPAKEKKFPGPPGLEEQLECDGLSEPGHWCIIPLAAGQAVSA
YSEERDRPYGLVSIDTVTVGDAEGLCVWPCSCEDDGYPAVNLDAGQESGPNSEDLLLVTD
PAFLSCGCVSSSGLRLGGSPGGLLDRLRLSFAKEGDWTADPPWRTGSPGGGSESEAGSPP
GLDMDTFDSGFAGSDCGSPVETDEGPPRSYLRQWVVRTPPPVDSGAQNS
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgccccggggcctggtgcctgccttactcctcctgattctccatggagcctggagctgc
ctggacctcacttgctacactgactacctctggaccatcacctgtgtcctggagacgcgg
agccccagccccagcatactcagtctcacctggcaagatgaatacgaggaacttcaggac
caagagacctcctgcagcctacacaggtctggccacaacaccacacatagatggtacacg
tgccatatgcgcttgtctcaattcctgtccgatgaagttttcgttgtcaacgtgacggac
cagtctggcaacaactcccgagagtgtggcagctttgtcctggctgagagcatcaagcca
gctgcccccttgaacgtgactgtgaccttctcaggacgctatgatatctcctgggactca
gcttatgacgaaccctccaactacgtgctgaggggcaagcttcagtatgagctgcagtat
cggaacctcagagacccctacgctgtgaggccggtgaccaagctgatctcagtggactca
agaaacgtctctcttctccctgaagagttccacaaagattctagctaccagctgcaggta
cgggcagcgcctcagccaggcacttcattcagggggacatggagtgagtggagtgacccc
gtcatctttcagacccaggctgaggagcccgaggcaggctgggaccctcacatgctgctg
ctcctggctgttttgatcattgtcctggttttcatgggtctgaagatccacctgccttgg
aggctatggaagaaggtatgggcaccagtgcccacccctgagagtttcttccagcccctg
tacagggagcacagcggaaacttcaagaattgggttaatacccctttcacagcctccagc
gtagagttgatgccacagagttccacaacaacatcagccttacatctgtcatcacatcca
gccaaggagaagaagttcccggggccgccgggtctggaagagcaactggagtgtgatgga
ttgtctgagcctggtcactggtgcataatccccttggcagctggccaagcggtctcagcc
tacagtgaggagagagaccggccgtatggtctggtgtccattgacacagtgaccgtgggg
gatgcagagggcctgtgtgtctggccctgtagctgtgaggatgatggctatccagccgtg
aacctggatgctggccaagagtctggccctaattcagaggatctgctcttggtcacagac
cctgcttttctgtcttgcggctgtgtttcaagtagtggtctcaggcttggaggctcccca
ggaggcctactggacaggttgaggctgtcatttgcaaaggaaggggactggacagcagac
ccaccctggagaactgggtccccaggagggggctctgagagtgaagcaggttcaccccct
ggtctggacatggacacatttgacagtggctttgcaggttcagactgtggcagccctgtg
gaaactgatgaaggaccccctcgaagttatctccgccagtgggtggtcaggacccctcca
cctgtggacagtggagcccagaacagctag

KEGG   Mus pahari (shrew mouse): 110331028
Entry
110331028         CDS       T05929                                 

Gene name
Pdgfra
Definition
(RefSeq) platelet-derived growth factor receptor alpha isoform X1
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah04010  MAPK signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04020  Calcium signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04144  Endocytosis
mpah04151  PI3K-Akt signaling pathway
mpah04510  Focal adhesion
mpah04540  Gap junction
mpah04630  JAK-STAT signaling pathway
mpah04810  Regulation of actin cytoskeleton
mpah05163  Human cytomegalovirus infection
mpah05200  Pathways in cancer
mpah05206  MicroRNAs in cancer
mpah05214  Glioma
mpah05215  Prostate cancer
mpah05218  Melanoma
mpah05230  Central carbon metabolism in cancer
mpah05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110331028 (Pdgfra)
   04014 Ras signaling pathway
    110331028 (Pdgfra)
   04015 Rap1 signaling pathway
    110331028 (Pdgfra)
   04630 JAK-STAT signaling pathway
    110331028 (Pdgfra)
   04020 Calcium signaling pathway
    110331028 (Pdgfra)
   04072 Phospholipase D signaling pathway
    110331028 (Pdgfra)
   04151 PI3K-Akt signaling pathway
    110331028 (Pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110331028 (Pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110331028 (Pdgfra)
   04540 Gap junction
    110331028 (Pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110331028 (Pdgfra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110331028 (Pdgfra)
   05206 MicroRNAs in cancer
    110331028 (Pdgfra)
   05230 Central carbon metabolism in cancer
    110331028 (Pdgfra)
   05231 Choline metabolism in cancer
    110331028 (Pdgfra)
  09162 Cancer: specific types
   05214 Glioma
    110331028 (Pdgfra)
   05218 Melanoma
    110331028 (Pdgfra)
   05215 Prostate cancer
    110331028 (Pdgfra)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    110331028 (Pdgfra)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110331028 (Pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110331028 (Pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110331028 (Pdgfra)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110331028 (Pdgfra)
Protein kinases [BR:mpah01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   110331028 (Pdgfra)
CD molecules [BR:mpah04090]
 Proteins
  110331028 (Pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE C2-set_2 LAT Kinase-like C1-set
Other DBs
NCBI-GeneID: 110331028
NCBI-ProteinID: XP_021067003
Ensembl: MGP_PahariEiJ_G0017089
LinkDB
Position
13
AA seq 1089 aa
MGTSHGVFLVLSCLLTGPGLIFCQLLLPSILPNENERIVQLNSSFSLRCLGESEVSWQHP
MSEEEDPNVEIRNEENNSGLFVTVLEVVNASAAHTGWYTCYYNHTQTDESEIEGRHIYIY
VPDPDMAFVPLGMTDSLVIVEEDDSAIIPCRTTDPETQVTLHNNGRLVLASYDSRQGFNG
TFSVGPYVCEATVKGRTFKTSEFNVYALKATSELNLEMDTRQTVYKAGETIVVTCAVFNN
EVVDLQWTYPGEVRNKGITMLEEIKLPSIKLVYTLTVPKATVKDSGEYECAARQATKEVK
EMKRVTISVHEKGFVEIKPTFGQLEAVNLHEVREFVVEVQAYPTPRISWLKDNLTLIENL
TEITTDVQKSQETRYESKLKLIRAKEEDSGHYTIIVQNDDDVKSYTFELSTLVPASILEL
VDDHHGSGGGQTVRCIAEGTPLPDINWMICKDIKKCNNDTSWTVLASNVSNIITELPRRS
RSTVEGRVSFAKVEETIAVRCMAKNNHSFVTRELKLVAPTLRSELTVAAAVLVLLVIVIV
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFMSQHPEKSKKDLDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRPLYDRPASYKKKSMLDSEVKN
LLSDDDSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVQCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKVHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacctcccacggggtctttctggtcctcagctgtctcctcacagggccgggcctc
atcttctgccagctcctattaccctctatcctcccaaatgagaatgagaggattgtgcag
ctgaattcgtccttttctctgagatgccttggggagagtgaagtgagctggcagcacccc
atgtctgaagaagaggaccccaacgtggaaatcaggaatgaggaaaacaacagtggcctc
tttgtcacagtgctggaagtggtcaacgcctccgcagcccacaccggatggtacacttgc
tactacaaccacactcagaccgatgagagtgagatcgagggcaggcacatttatatctat
gtaccagacccagacatggcctttgtgcctctcgggatgacagattctttagtcatcgtg
gaagaggatgattctgccatcataccttgtcgcaccacagatccggagactcaagtcacc
ttgcacaataacgggaggctggtgcttgcctcctatgacagcaggcagggcttcaacggg
accttcagcgtggggccttacgtctgtgaggccaccgtcaaagggaggacgttcaagacc
agcgagtttaacgtttacgccttgaaagcaacgtcagaactgaatctggagatggacaca
cgacagaccgtgtataaggcaggagaaacgatcgtggtgacctgtgccgtctttaacaat
gaggtcgttgatctgcagtggacttaccccggagaagtgagaaacaaaggcatcaccatg
ttggaggagatcaaactcccatccatcaaactggtgtacactttgactgtccccaaggcc
acggtgaaggacagcggagagtatgaatgcgctgcccgtcaggccacgaaagaggtcaag
gaaatgaagagagtcaccatttctgtccacgagaaaggcttcgtggagatcaagcccacc
tttggccagctggaagctgtcaacttgcatgaagtcagagaatttgtggtggaggtgcag
gcctacccgacacccaggatatcgtggctgaaggacaacttgactctaatagagaatctc
accgagatcaccaccgacgtacagaagagccaggaaacaaggtatgaaagcaaattaaag
ctgattcgcgctaaggaagaagacagtggccattacaccattatagttcaaaatgacgat
gacgtgaagagttacacgtttgagctgtcaactctagttcctgcgtccattctggagctc
gtagatgaccaccatggctctggcgggggacagactgtgaggtgcatagctgaaggcacc
cctcttccggacatcaactggatgatctgcaaggatattaagaaatgtaataatgatact
tcatggaccgttttggccagcaatgtctcgaatattatcacagagctccctcgccgcagc
aggagtaccgtggagggacgagtgtccttcgccaaagtggaagaaaccatcgcagttcga
tgcatggcaaagaacaaccacagctttgtgacccgggaactgaagctggtggctcccacc
ctgcgatctgaactcacagtggcggccgcagtgctggtgctgttggtgattgtcattgtc
tctctcatcgtcctggtggtcatttggaagcagaaaccacggtatgaaattcgctggagg
gtcatcgagtcgatcagccccgacggacatgagtatatctatgtggaccccatgcagttg
ccttacgactccagatgggaattcccaagagatggcctagtgcttggtcggattttggga
tccggtgcatttgggaaagtggttgaaggcacagcttatggattaagccggtcccagcct
gtaatgaaggtggctgtgaagatgctcaaacccacagccaggtctagtgaaaagcaagct
ctcatgtccgagctgaagataatgactcacttggggccgcatttgaacattgtgaacttg
ctgggagcctgcaccaagtcaggccccatttacatcatcacagaatactgtttctatggg
gacttggtcaactacttgcataagaacagagatagcttcatgagccaacacccagaaaag
tcaaagaaagacctggacatctttggattgaatcctgcagacgagagcacaagaagttat
gtgattttgtcttttgaaaataatggcgactacatggacatgaagcaagccgacaccaca
cagtatgtccccatgcttgaaaggaaagaggtttctaagtactctgacatccagagaccg
ctgtacgatcggccggcctcctacaagaagaaatccatgctagactcagaagtaaaaaac
ctcctttctgacgatgactccgagggtctgactttgctggatctattgagcttcacctat
caagttgcccgagggatggaatttttggcttcaaaaaattgtgtccaccgggacctggct
gcccgcaacgttctcctggcgcaagggaaaattgtgaagatctgtgactttggcctggcc
agagacatcatgcacgattccaactacgtgtcaaaaggcagtactttcctgcctgtgaag
tggatggcacccgagagcatcttcgacaacctctacaccacgctgagtgacgtctggtcc
tatggcattctgctctgggaaatcttttcccttggtggcacaccctatcctggcatgatg
gttgattctactttctacaataagatcaagagtggataccggatggccaaacctgaccat
gccaccagtgaagtctacgagatcatggtgcagtgctggaacagtgagcccgagaagaga
ccctccttttaccacctcagcgagatagtggagaatctgctgcctggacaatacaagaag
agttatgaaaaggttcacctggacttcctaaagagtgaccatccggctgtggcacgcatg
cgcgtggactctgataacgcgtacatcggtgtcacttacaaaaatgaagaggacaagctg
aaggactgggaagggggcctggacgaacagagactgagcgcagacagcggctacatcatc
cccctgccagacattgaccctgttccagaggaggaagacctgggcaagaggaacagacac
agctcacagacttcggaagagagtgccatcgagacaggttccagtagttccaccttcatc
aagagagaagatgagaccatcgaggacatcgacatgatggatgacattggtatagattcc
tcagacctggtggaggacagcttcctgtaa

KEGG   Mus pahari (shrew mouse): 110332526
Entry
110332526         CDS       T05929                                 

Gene name
Il9r
Definition
(RefSeq) interleukin-9 receptor
  KO
K05073  interleukin 9 receptor
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04630  JAK-STAT signaling pathway
mpah04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110332526 (Il9r)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110332526 (Il9r)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110332526 (Il9r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110332526 (Il9r)
   04090 CD molecules [BR:mpah04090]
    110332526 (Il9r)
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  IL2 receptor family
   110332526 (Il9r)
CD molecules [BR:mpah04090]
 Proteins
  110332526 (Il9r)
SSDB
Motif
Pfam: IL2RB_N1
Other DBs
NCBI-GeneID: 110332526
NCBI-ProteinID: XP_021069452
Ensembl: MGP_PahariEiJ_G0017311
LinkDB
Position
14
AA seq 471 aa
MALGRCIAEGWTLERVAVRQLSWLLIYSCVCSGVCWGVLVPEQGGGGWKAGTLTCLSNSV
FRIDCRWSAPELGQASGAWLLFTSNQVTDIKHKCTFWGSMCTLVLPKEEVFLPFDNFTIT
LHRCIMGQEQVSLVDSQYLPRRHIKLDPPSDLQSNVSSGRCVLTWGISLALEPLITSLSY
ELAFKRQEEAWEQARHKDRIVGVTWLILEAVELHPGSIYEARLRVQMALESYDDKTEGGY
YKSHWSEWSQPVSFPSPQRRRQGLLVPRWQPSASILVVVPIFLLLTGFVHLLFKLSPRVK
RIFYQNVPSPEAFFHPLYSVYHGDFQTWTGARRAGGPQARQDGVSTSSAGSESSIWEAVA
TLTYSPACPVQFACLKWEATAPGFPGPPGSEHVLPAGCLELEGQPSAYLPQEDWAPLGSA
RPPPPDSDSGSSDYCMLDCCEECHLSAFPGHTQSPELTPAQPVALPVSSRT
NT seq 1416 nt   +upstreamnt  +downstreamnt
atggccctgggaagatgcattgcagaaggttggaccttggagagagtagcagtgcgacag
ctctcctggctcctgatctacagctgtgtctgctccggtgtctgctggggagtcttggtc
ccagagcaaggaggaggagggtggaaggctgggacactcacctgcctcagcaacagtgtt
ttcaggatcgactgccgttggtcagcaccagagctgggccaggcatccggggcctggctc
ctctttaccagtaaccaggtgactgacatcaagcacaagtgcaccttctggggcagtatg
tgtaccctggtgctgcctaaagaggaggtgttcttaccttttgacaacttcaccatcaca
cttcaccgctgcatcatgggacaggaacaggtcagcctggtggactcgcagtacctgccg
aggagacacatcaagttggatccaccctctgatctgcagagcaatgtcagctctgggcgt
tgtgtcctgacctggggtatcagtctcgccctggagccattgatcacatccctcagctac
gagctggccttcaagcggcaggaagaggcctgggagcaggcccggcacaaggaccgtatc
gttggcgtgacctggctcatccttgaagccgtcgaactgcatcctggttccatctacgag
gccaggctgcgcgtccagatggctttggagagctatgacgacaagacggaggggggatat
tacaagagccattggagtgagtggagtcagcccgtgtcctttccttctccccagaggagg
agacagggcctcctggtcccacgctggcagccgtcagccagcatccttgttgttgtgccc
atctttcttcttctgactggctttgtccaccttctgttcaagctgtcacccagggtgaag
agaatcttttaccagaacgttccctctcccgaggcattcttccatcctctctacagtgtg
taccatggggacttccagacttggacaggggcccgcagagccggcggaccacaagcaaga
caggatggtgtcagtacttcatcagcaggctcagagtccagcatctgggaggccgtcgcc
acactcacctatagcccggcatgccctgtgcagtttgcctgcctgaagtgggaggccaca
gcccctggcttcccagggcccccaggctcagagcatgtgctgccggcagggtgtctggag
ttagaaggacagccgtctgcctacctgccccaggaggactgggccccactgggctctgcc
aggccccctcctccagattcagacagcggcagcagcgactattgcatgttggactgctgt
gaggagtgccacctctcagccttcccaggacacacccagagtcctgagctcacaccggct
cagcctgtggccctccccgtgtccagcaggacctga

KEGG   Mus pahari (shrew mouse): 110333065
Entry
110333065         CDS       T05929                                 

Gene name
Pdgfrb
Definition
(RefSeq) platelet-derived growth factor receptor beta isoform X1
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah04010  MAPK signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04020  Calcium signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04510  Focal adhesion
mpah04540  Gap junction
mpah04630  JAK-STAT signaling pathway
mpah04810  Regulation of actin cytoskeleton
mpah05165  Human papillomavirus infection
mpah05200  Pathways in cancer
mpah05206  MicroRNAs in cancer
mpah05214  Glioma
mpah05215  Prostate cancer
mpah05218  Melanoma
mpah05230  Central carbon metabolism in cancer
mpah05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110333065 (Pdgfrb)
   04014 Ras signaling pathway
    110333065 (Pdgfrb)
   04015 Rap1 signaling pathway
    110333065 (Pdgfrb)
   04630 JAK-STAT signaling pathway
    110333065 (Pdgfrb)
   04020 Calcium signaling pathway
    110333065 (Pdgfrb)
   04072 Phospholipase D signaling pathway
    110333065 (Pdgfrb)
   04151 PI3K-Akt signaling pathway
    110333065 (Pdgfrb)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110333065 (Pdgfrb)
   04540 Gap junction
    110333065 (Pdgfrb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110333065 (Pdgfrb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110333065 (Pdgfrb)
   05206 MicroRNAs in cancer
    110333065 (Pdgfrb)
   05230 Central carbon metabolism in cancer
    110333065 (Pdgfrb)
   05231 Choline metabolism in cancer
    110333065 (Pdgfrb)
  09162 Cancer: specific types
   05214 Glioma
    110333065 (Pdgfrb)
   05218 Melanoma
    110333065 (Pdgfrb)
   05215 Prostate cancer
    110333065 (Pdgfrb)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110333065 (Pdgfrb)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110333065 (Pdgfrb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110333065 (Pdgfrb)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110333065 (Pdgfrb)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110333065 (Pdgfrb)
Protein kinases [BR:mpah01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   110333065 (Pdgfrb)
CD molecules [BR:mpah04090]
 Proteins
  110333065 (Pdgfrb)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 V-set Ig_6 C2-set_2
Other DBs
NCBI-GeneID: 110333065
NCBI-ProteinID: XP_021070125
Ensembl: MGP_PahariEiJ_G0019048
LinkDB
Position
15
AA seq 1099 aa
MGLPGVMPASVLRGQLLLSVLWLLGPQTSRGLVITPPGPEFVLNISSTFVLTCSSSAPVM
WEQMSQVPWQETAMNQDGTFSSVLTLTNVTGGDTGEYFCVYNNSLGSELSERKRIYIFVP
DPTMGFLPMDSEDLFIFVTDVTETTIPCRVTDPRLEVTLHEKKVDIPLHVPYDHQRGFTG
TFEDKTYICKTTIGDKEVDSDTYYVYSLQVSSINVSVNAMQTVVRRGESITIRCIVMGND
VVNFQWTYPRMKSGRLVEPVTDYLFGVPSRIGSILHIPTAELSDSGTYTCNVSVSVNDHG
DEKAINITVIENGYVRLLETLGDVQIAELHRSRTLQVELEAYPTPSVLWLKDNRTLGDSS
AGELVLSTRNVSETRYVSELTLVRVKVSEAGYYTMRAFHEDDEVQLSFKLQVNVPVRVLE
LSESHPANGEQTIRCRGRGMPQPNVTWSTCRDLKSRCPRKLSPTPLGNSSKEESQLETNV
TFWEEDQEYEVVSTLRLRHVDQPLSVRCMLQNSMGRDSQEVTVVPHSLPFKVVVISTILA
LVVLTVISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPVQLPYDSTWELPRDQL
VLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGP
HLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQRHSNKHCPPSAELYSNAL
PVGFSLPSHLNLTGESDGGYMDMSKDESVDYVPMLDMKGDIKYADIESSSYMAPYDNYVP
SAPERTYRATLINDSPVLSYTDLVGFSYQVANGMDFLASKNCVHRDLAARNVLICEGKLV
KICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLG
GTPYPELPMNDQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFETRPPFSQLVLLLER
LLGEGYKKKYQQVDEEFLRSDHPAILRSQARFPGIHSLRSPLDTSSVLYTAVQPNESDND
YIIPLPDPKPDAADEGLPEGSPSLASSTLNEVNTSSTISCDSPLELQEEPQQAEPEAQLE
QPQDSGCPEPLAEAEDSFL
NT seq 3300 nt   +upstreamnt  +downstreamnt
atggggcttccaggagtgatgccagcttcagtcctcagaggccagttgctgctctccgtg
ctatggctcctgggaccgcagacctcccggggcctagtcatcacgccccctgggccagag
tttgtcctcaacatctccagcacctttgttctgacctgctcgagttcagctcctgtgatg
tgggaacagatgtcccaggtgccctggcaagaaacggccatgaatcaggacggcaccttc
tccagtgtgctgacactgaccaatgtcaccgggggagacactggggaatacttttgtgtc
tacaacaactcactagggtcagagctcagtgagaggaagcgtatctatatcttcgtgcca
gatcccaccatgggcttcctccctatggactccgaggacctgttcatttttgtcacggat
gtcactgagacgacaattccgtgccgagtgacagacccccggctggaggtgacgctgcat
gagaagaaagtggatatccccctacatgtaccctacgaccaccaacgaggtttcactggt
acttttgaggacaagacttacatttgcaaaaccaccattggggacaaggaagtggattcc
gatacttactacgtctacagcctccaggtgtcatccatcaatgtctctgtgaatgccatg
cagactgtggtccgccggggtgagagcatcactatcaggtgcattgtgatgggcaatgat
gtggtcaacttccagtggacttacccccgcatgaagagtgggcgactggtggagccagtg
acagactacctttttggagtgccctcccgcattggctccatcctgcatatccccacggct
gagctgagtgactcgggcacctatacttgcaacgtgtcagtgagtgtgaacgaccatggc
gacgagaaagccatcaacatcactgtgatcgagaatggctacgtgcggctgctggaaaca
ctgggagatgtacagattgctgagctgcaccggagccggacgctgcaggtggagttggag
gcttatccgacgccctcggtcctgtggctcaaggacaaccgtaccttgggtgactccagc
gctggcgagttagttctgtctactcgcaacgtgtctgagacccggtacgtgtcagaactg
accttggtacgtgtgaaggtgtcagaagcgggctactatactatgcgagccttccacgag
gatgacgaggtccagctctccttcaagctgcaggtcaatgtccctgtccgtgtgctggag
ctgagtgagagtcaccctgccaatggggagcagacaatccgctgtcgtggccggggtatg
cctcagccaaatgtcacctggtctacctgcagagacctcaaaagcaggtgtccacgaaaa
ctgtcacccacacccttggggaatagttccaaagaggagagtcagctagaaacgaatgtg
actttctgggaggaagatcaggaatatgaggtggtgagcacactgcgcctgcgccacgtg
gaccagccactgtcggtacgctgtatgctgcagaactccatgggcagagattcgcaggag
gtcaccgtggtcccacattccttgcccttcaaagtggtggtgatctcaaccatcctggcc
ttagtggtccttaccgtcatctctctcatcatcctcatcatgctgtggcagaagaagcca
cgctatgagatccgatggaaggtcatcgagtctgtgagctctgacggtcatgagtacatc
tacgtggaccccgtgcagctgccttacgactccacctgggagctgccacgggaccagctt
gttctgggacggactcttggctctggggctttcggacaggtggtggaggccacggctcat
ggtctgagccattcgcaggccaccatgaaagtggctgtcaagatgctgaaatctacagcc
agaagtagtgagaagcaggccctcatgtcggagctgaagattatgagtcatctaggaccc
cacctgaacgtggtcaacctgctgggggcctgcaccaaaggaggtcccatctacatcatc
acggaatactgccgctacggcgacctggtggactacctacacaggaacaaacacaccttc
ttgcagcgacactccaacaagcattgtccacccagcgctgagctctacagcaacgccctg
ccggtggggttctccctacccagccacttgaacctgactggggagagcgatggtggttac
atggatatgagcaaggatgaatctgtagattacgtgcccatgttggacatgaaaggagac
atcaaatatgcagacattgagtcctccagctacatggccccttatgataactatgtccca
tctgcccctgaaaggacctatcgtgccaccttaatcaatgactcaccagtgctcagctac
acagacctcgtgggcttcagctaccaagtggccaatggcatggacttcttagcctctaag
aactgtgttcaccgagacctggcggccaggaatgtgctcatctgcgagggcaaactggtc
aagatctgtgacttcggcctggctcgagacatcatgagggactcaaactacatctccaaa
ggcagtaccttcctgcctctgaagtggatggcccccgagagcatcttcaacagcctttac
accaccttgagcgatgtctggtcctttgggatcctgctctgggagatcttcacactgggt
ggcaccccttacccagagctgcccatgaatgaccagttctacaatgccatcaagaggggc
taccgcatggcccagcctgctcatgcctccgacgagatctatgagatcatgcaaaaatgc
tgggaagaaaagtttgagactcgaccccccttctcccagctggtgctgctcctggagagg
cttctgggtgaaggctataaaaagaagtaccagcaggtagatgaggagttcctgaggagt
gaccatccagccatcctgaggtcccaagcccgctttccaggaatccacagcctccgatcc
cctctggacaccagctctgtcctctacactgccgtgcagcccaatgagagtgacaatgac
tacatcatccccttacctgaccccaagcctgacgctgctgatgaaggtctcccagagggg
tcccccagccttgccagctccaccttgaatgaagtcaacacttcctccaccatctcctgt
gacagtcccctggagctccaagaagagccgcagcaagcagagcctgaggcacagctggag
cagccacaggattcaggatgcccagaacctctggctgaagcagaggacagcttcctgtag

KEGG   Mus pahari (shrew mouse): 110333882
Entry
110333882         CDS       T05929                                 

Gene name
Il15ra
Definition
(RefSeq) interleukin-15 receptor subunit alpha isoform X1
  KO
K05074  interleukin 15 receptor alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04630  JAK-STAT signaling pathway
mpah04672  Intestinal immune network for IgA production
mpah05166  Human T-cell leukemia virus 1 infection
mpah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110333882 (Il15ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110333882 (Il15ra)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    110333882 (Il15ra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110333882 (Il15ra)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110333882 (Il15ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110333882 (Il15ra)
   04090 CD molecules [BR:mpah04090]
    110333882 (Il15ra)
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  IL2 receptor family
   110333882 (Il15ra)
CD molecules [BR:mpah04090]
 Proteins
  110333882 (Il15ra)
SSDB
Motif
Pfam: Sushi DUF3180 TGBp3
Other DBs
NCBI-GeneID: 110333882
NCBI-ProteinID: XP_021071311
Ensembl: MGP_PahariEiJ_G0019236
LinkDB
Position
16
AA seq 265 aa
MTSPQLRGYGVHALPVLLLLLLLLLLLLPLRVTPGTTCPPPISIEHADIRVKNYSVNSRE
RYVCNSGFKRKAGTSTLTECVINKNTNVAHWTTPSLKCIRDPSLAHYSPVPTVATPKVTS
QPESPSPPAKEPEAFSPKSDTTVTTETAIMPGSRLTPSQPTSTGTTGTGSHKSSRAPSLA
ATMTLEPTASTSLGITEISPQSSKMTNVAISTSVLLVGAGLVVAFLAWYIKSRQTSQPCR
VEVETTETLPMTVRASSKEDEDTGT
NT seq 798 nt   +upstreamnt  +downstreamnt
atgacctcgccgcagctccggggctatggagtccacgccctcccggtgttgctgctgctg
ctgctgctgttactactgttgctcccgctgagggtgacgccgggcaccacatgtccaccc
cccatatctattgagcatgcagatatccgggtcaagaactacagtgtgaactccagggag
aggtatgtctgtaactctggcttcaagcggaaagctggaacatccaccctgaccgagtgt
gtgatcaacaagaacacaaatgttgcccactggacaactcccagcctcaagtgcatcaga
gacccctccctagctcactacagtccagtgccaacagtagcgacaccaaaggtgacctca
cagccagagagcccctcccctcctgcaaaagagccagaagctttctctcccaaatcagat
accacagtgaccacagagacagctattatgcctggctccaggctgacaccatcccaacca
acttctacaggaactacagggacaggcagtcacaagtcctcccgagccccatctcttgca
gcaacaatgaccttggagcctacagcctccacctccctcgggataacagagatttctccc
cagagctccaaaatgacaaatgtggccatctctacatcggtcctcttggttggtgcaggg
cttgtggtggctttcctggcctggtacatcaaatcaaggcagacttcccagccatgccgt
gttgaggtggaaaccacggaaacactaccaatgactgtgagggccagcagcaaggaggac
gaagacacaggaacctaa

KEGG   Mus pahari (shrew mouse): 110334116
Entry
110334116         CDS       T05929                                 

Gene name
Il2ra
Definition
(RefSeq) interleukin-2 receptor subunit alpha
  KO
K05068  interleukin 2 receptor alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04061  Viral protein interaction with cytokine and cytokine receptor
mpah04144  Endocytosis
mpah04151  PI3K-Akt signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04640  Hematopoietic cell lineage
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah05162  Measles
mpah05166  Human T-cell leukemia virus 1 infection
mpah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110334116 (Il2ra)
   04151 PI3K-Akt signaling pathway
    110334116 (Il2ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110334116 (Il2ra)
   04061 Viral protein interaction with cytokine and cytokine receptor
    110334116 (Il2ra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110334116 (Il2ra)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110334116 (Il2ra)
   04658 Th1 and Th2 cell differentiation
    110334116 (Il2ra)
   04659 Th17 cell differentiation
    110334116 (Il2ra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110334116 (Il2ra)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110334116 (Il2ra)
   05162 Measles
    110334116 (Il2ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110334116 (Il2ra)
   04090 CD molecules [BR:mpah04090]
    110334116 (Il2ra)
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  IL2 receptor family
   110334116 (Il2ra)
CD molecules [BR:mpah04090]
 Proteins
  110334116 (Il2ra)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 110334116
NCBI-ProteinID: XP_021071633
Ensembl: MGP_PahariEiJ_G0019235
LinkDB
Position
16
AA seq 267 aa
MEPRLLMLGFLSLTIVPSCRAELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLKE
LVYMLCLGNSWSSSCQCTSNSHDKSRETVTPQPEHQTEQQTRDVQKSTESMHQENLTGHC
REPPPWEHEDSKRIYHFVEGQRVHYECIPGYKALQRGPAFSICKMKCEKTGWTQPRLTCV
DEREYHQFLASEEFQGSRNSFPESDTSCPITTTDFPQPTETTATTETFVLTMEYQVAVAG
CLFLLISILLLSGLTWQHRWRKGRRTI
NT seq 804 nt   +upstreamnt  +downstreamnt
atggagccacgcttgctgatgttggggtttctctcattaaccatagtacccagttgtcgg
gcagagctgtgtctctatgacccacccgaggtccccaatgccacattcaaagccctctcc
tacaagaatggcaccatcctaaactgtgaatgcaagagaggtttccgaagactaaaggaa
ctggtctatatgctttgcttaggaaactcctggagcagcagctgccagtgcaccagcaac
tcccatgacaaatcaagagagacagttacaccgcaacctgaacaccagacagagcaacaa
accagagatgtgcagaaatcaacagagtctatgcaccaagagaaccttacgggtcactgc
agggagccccctccttgggaacacgaagattccaagagaatctatcatttcgtggaagga
cagagagttcactacgagtgtattccaggatacaaggctctacagagaggtcctgctttc
agcatctgcaagatgaagtgtgagaagacggggtggactcagccccggctcacttgtgta
gatgaaagagaataccatcaatttctggcgagtgaagaatttcaaggaagcagaaattct
tttcctgagagtgacacttcctgtcccatcaccaccacagacttcccacaacccacagaa
acaactgcaactacagagacatttgtgctcacaatggagtatcaggtagcagtggctggc
tgcctcttcctgctcatcagcatactcctcctgagcgggctcacctggcagcacagatgg
aggaagggcagaagaaccatctag

KEGG   Mus pahari (shrew mouse): 110334519
Entry
110334519         CDS       T05929                                 

Definition
(RefSeq) cytokine receptor common subunit beta-like
  KO
K04738  cytokine receptor common subunit beta
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04210  Apoptosis
mpah04630  JAK-STAT signaling pathway
mpah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110334519
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110334519
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110334519
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110334519
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110334519
   04090 CD molecules [BR:mpah04090]
    110334519
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  IL3 receptor family
   110334519
CD molecules [BR:mpah04090]
 Proteins
  110334519
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3 Pur_ac_phosph_N IL4Ra_N Comm IL6Ra-bind IL2RB_N1 TTSSLRR Hema_esterase
Other DBs
NCBI-GeneID: 110334519
NCBI-ProteinID: XP_021071918
LinkDB
Position
17
AA seq 711 aa
PLKTLQCYNDYTNHIICSWADTEDAQGLINITLYHQLEKNQPVSCVLSEELMWSECPSSH
RCVPRRCVIPYTRFANTNEDYYSFRPDRDLGIQLRVPLAQHVQPPTPKDIRISPSGNHFL
MEWNVTLGDAQVSWLSSKDIEFEVAYKRLQDSWECDVQMEPPTLNLTKNRDSYSLHWETQ
KIPTYIEHTFQVQYKKKSDSWKDSKTENLDRAHSMDLPQLEPDTSYCARVRVKATSDYDG
IWSEWSNECTWTTEWVMPMLWIVLILVFLILTLILALRVGCVYGYRTYRTWKEKIPNPSK
SLLFQDGGKGLWPTGSMAAFTTKNPMHQGPQSSLFTEQQGVSYTHLEDKDLSPLTVEDPN
MILDPPSRPDTTPTASSEPTEQLPNVQVHAPTPSGRPRKQLPSFDFNGPYLGPPQTHSLT
DLPGQLGSPQVGGNLKPALPGSLEYMCLPPGGQVQLVPLSQVMGQGQVVDVQCGSSLETT
GSPSVEPKESPPVELSVEEEEPRDNPVTLPISSGGPEDIMVASDYVTPGDLVLTLPTGPL
STSLGPSLGLPSAQSPSLCLKLPRVPSGSPALGSPVFEDYVELPPSVSEAAKSPPGHPAL
PVAGSPTASPGEPREEVGPASPHPEGLLVLQQVGDYCFLPGLGPGSLSPHSKPPSPGLCS
ETEDLDQDLSVKKFPYQPMPQVPAIQFFKSLKQQDYLSLPPWDNSQPGKVC
NT seq 2136 nt   +upstreamnt  +downstreamnt
cctctgaagactctgcagtgctacaacgactacaccaaccacatcatctgcagctgggca
gacacggaggatgctcaggggctaatcaacatcaccctctatcaccagctagagaagaat
caaccagtgtcctgtgtgcttagtgaggagctcatgtggtcagagtgcccctcatcccac
cgctgtgtgcccagaagatgtgtcatcccctatacacgatttgccaacacaaatgaagat
tactactccttccggccagatcgtgatctgggcatccagctcagggttccactggcccag
catgtgcagccaccgactcccaaggacatccgcatcagcccctctgggaatcatttcctg
atggagtggaatgtgacccttggagatgcccaggtctcctggctttcatcaaaggacata
gagtttgaggtggcttataagagacttcaggactcctgggagtgtgatgtccagatggag
cctccaaccctcaacctaacgaagaacagagacagctacagcctgcattgggaaactcag
aaaatacccacatatattgagcacacattccaggtccagtacaagaagaagtcagacagc
tggaaggacagcaagacagagaacctagatcgagcccatagcatggacctgccccagctg
gagccagacacctcatactgtgccagggtgagggtcaaggccacctctgactacgatggg
atctggagcgagtggagcaatgagtgtacttggacgactgagtgggtgatgcccatgctg
tggatagtcctcatcctggtctttctcatcctcaccttgatcctggccctccgcgttggc
tgtgtctatgggtacaggacatacaggacatggaaggagaagattcccaaccccagcaag
agcctcctgttccaggatggaggtaaaggtctctggcctactggcagcatggcagccttc
accaccaagaaccccatgcaccaggggccacagagcagccttttcactgagcaacagggg
gtgtcatatacacatttggaggacaaagacctgtcacctctcaccgtagaggaccctaac
atgattctagatccaccatctaggcctgatacaaccccaactgcctcatccgaacccacg
gagcaacttcccaatgttcaagtacatgcaccaactccttctggcagacctaggaagcaa
ttacccagttttgacttcaatgggccctacctggggcctccccaaacccactccctgact
gacctcccaggacagctgggttccccccaggtgggtgggaacctgaagccagcactgcca
ggctccttggagtacatgtgtctgccccctggaggacaagtccaactggtcccattgtcc
caggtgatgggacagggccaggttgtggatgtgcagtgtgggtccagcctggagaccaca
gggagcccttctgtggaaccaaaggagagccctccagttgagctgagtgtggaggaagag
gagccaagggacaacccagtgactctgcccataagctctgggggccctgaggacattatg
gtagcctctgattatgtcactcctggagatctggtgctcactctgcccacagggcccctg
tctacctctctgggcccctctctagggttgccctcagcccaaagccccagtctctgtctt
aagctgcccagggtcccctctggaagcccagctcttgggtcacccgtgtttgaggactat
gtggagctgcctccaagtgtgagcgaggctgccaagtcccctccaggccatcctgctctt
cctgtggcaggcagccccacagccagcccaggagagcccagggaggaagtgggccctgca
tccccacaccccgaaggcctccttgttcttcagcaggttggggactactgcttcctccct
ggcctgggacctggctccctctcaccacacagtaagccaccctccccaggcctgtgctct
gagactgaggacctagaccaggacttgtctgtgaaaaagtttccctatcaacccatgccc
caggtgccagccattcagtttttcaaatccctaaagcagcaggactacctgtccctgccc
ccttgggacaatagccagcctgggaaggtgtgctga

KEGG   Mus pahari (shrew mouse): 110334939
Entry
110334939         CDS       T05929                                 

Definition
(RefSeq) cytokine receptor common subunit beta isoform X1
  KO
K04738  cytokine receptor common subunit beta
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04210  Apoptosis
mpah04630  JAK-STAT signaling pathway
mpah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110334939
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110334939
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110334939
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110334939
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110334939
   04090 CD molecules [BR:mpah04090]
    110334939
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  IL3 receptor family
   110334939
CD molecules [BR:mpah04090]
 Proteins
  110334939
SSDB
Motif
Pfam: IL6Ra-bind EpoR_lig-bind fn3 Tissue_fac IL4Ra_N Interfer-bind Pur_ac_phosph_N IL2RB_N1 Comm Deltaretro_Tax
Other DBs
NCBI-GeneID: 110334939
NCBI-ProteinID: XP_021072650
Ensembl: MGP_PahariEiJ_G0019980
LinkDB
Position
17
AA seq 896 aa
MHQQMALTWGLCYMALVALCWXHGVTEAEETVPLKTLQCYNDYTNHIICSWADTEDAQGL
INITLYHQLEKNQPVSCVLSEELMWSECPSSHRCVPRRCVIPYTRFSITNEDYYSFRPDR
DLGIQLMVPLAQHVQPPPPKDIRISPSGDHFLMEWNVTLGDAQVSWLSSKDIEFEVAYKR
LQDSWEDASTLHTTNFQVTLEPKLFLPNIIYAARVRTRLSPGSSLSGRPSRWSPEVHWDS
QPGDKAQPQNLQCFFDGIQSLHCSWEVWTQATGSVSFGLFXRPSPAAPEEKCSPVVKELQ
ASVYTRYRCSLPVPDPSAHSQYTVSVKPLEQGKVIMNYNHIQMEPPTLNLTKNRDSFSLH
WDTQKMAYSFIEHTFQVQYKKKSDSWEDSKTENLDRAHSMDLPQLEPDTSYCARVRVRPI
SNYDGIWSEWSDECTWTTEWVMPTLWIVLILVFLILTLILALRVGCVYGYRTYRTWKEKI
PNPSKSLLFQDGGKGLRLPGSMAAVTTKNPKSQGPQSSLFAEQQGVSYTHLEDNDLSPLT
IEDPNMILDPPSGLDTTPAASSEPTEQLPNVQVHAPTPSGRPRKQLPSFDFNGPYLGPPQ
THSLPDLPDQVGSPQVGGSLKPALPGSLEYMCLPPGGQVQLVPLSQVMGQGQVVDVQCGS
SLETTGSPSVEPKESPPVELSVEEQEPRDNPVTLPISSGGPEDIMVASDYVTPGDLVLTL
PTGPLSTSLGPSLGLPSAQSPSLCLKLPRVPSGSPALGLPEFEDYVELPPSVSQAAKSPP
GHPALPVAGSPTVSPGEPREEVGPASPHPEGLLVLQQVGDYCFLPGLGPGSLSPHSKPPS
PGLCSETEDLDQDLSVKKFPYQPMPQVPAIQFFKSLKQQDYLSLPPWDNSQPGKVC
NT seq 2691 nt   +upstreamnt  +downstreamnt
atgcaccagcaaatggcactcacctgggggctgtgctacatggccctggtggctctctgc
tgggnacacggggtgacagaggcagaagaaactgtccctctgaagactctgcagtgctac
aacgactacaccaaccacatcatctgcagctgggcagacacggaggatgctcaggggcta
atcaacatcaccctctatcaccagctagagaagaatcaacccgtgtcctgtgtgcttagt
gaggagctcatgtggtcagagtgcccctcatcccaccgctgtgtgcccagaagatgtgtc
atcccctatacacgattttccatcacaaacgaagattactactccttccggccagatcgt
gatctgggcatacagctcatggtcccactggcccagcatgtgcaaccaccacctcccaag
gacatccgcatcagcccctctggggatcatttcctgatggagtggaatgtgacccttgga
gatgcccaggtctcctggctttcatcaaaggacatagagtttgaggtggcttataagaga
cttcaggactcctgggaggatgcctccaccctccatactaccaactttcaggtgacttta
gagccaaagctgttcctacccaacattatctatgcggcccgtgtgcgcactcgactgtcc
ccaggttcaagcttgtctgggagacccagcagatggagcccagaggttcactgggactcc
cagccaggggacaaggcccagccacagaaccttcagtgcttctttgatgggatccagtct
ctccactgctcctgggaggtgtggacccaggcgactggctctgtttcctttgggctcttc
tntcgccccagccctgcagctccggaggagaaatgctctccggtggtgaaggagctgcag
gccagcgtctacacccgctaccgctgcagtctacctgtgcctgaccccagtgcacacagc
cagtacacagtctctgttaagcccctggaacaagggaaggtcatcatgaactataaccac
atccagatggagcctccaaccctcaacctgaccaagaacagagacagcttcagcctgcat
tgggacactcagaagatggcttactcattcattgagcacacatttcaggtccagtacaag
aagaagtcagacagctgggaggacagcaagacagagaacctagatcgagcccatagcatg
gacctgccccagctggagccagacacctcatactgcgccagggtgagggtcaggcccatc
tctaactacgatgggatctggagcgagtggagcgatgagtgcacttggacgactgagtgg
gtgatgcccacgctgtggatagtcctcatcctggtctttctcatcctcaccttgatcctg
gccctccgcgttggctgtgtctatgggtacaggacatacaggacatggaaggagaagatt
cccaaccccagcaagagcctcctgttccaggatggaggtaagggactcaggcttcctggc
agcatggcagccgtcaccaccaagaaccccaaatcccaggggccacagagcagccttttc
gctgagcaacagggggtgtcatatacacatttggaggacaatgacctgtcacctctcacc
atagaggaccctaacatgattctagatccaccatctgggcttgatacaaccccagctgcc
tcatccgaacccacggagcaacttcccaatgttcaagtacacgcaccaactccttctggc
agacctaggaagcaattacccagctttgactttaatgggccctacctggggcctccccaa
acccactccctgcctgacctcccagaccaggtgggttccccccaggtgggtgggagcctg
aagccagcactgccaggctccttggagtacatgtgtctgccccctggaggacaagtccaa
ctggtcccattgtcccaggtgatgggacagggccaggttgtggatgtgcagtgtgggtcc
agcctggagaccacagggagcccttctgtggaaccaaaggagagccctccagttgagctg
agtgtggaggaacaggagccaagggacaacccagtgactctgcccataagctctgggggc
cctgaggacattatggtagcctctgattatgtcactcctggagatctggtgctcactctg
cccacagggcccctgtctacctctctgggcccctctctagggttgccctcagcccaaagc
cccagtctctgtcttaagctgcccagggtcccctctggaagcccagctcttgggttacct
gagtttgaggactatgtggagctgcctccaagtgtgagccaggctgccaagtcccctcca
ggccatcctgctcttcctgtggcaggcagccccacagtgagcccaggagagcccagggag
gaagtgggccctgcatccccacaccccgaaggcctccttgtccttcagcaggttggggac
tactgcttcctccctggcctgggacctggctccctctcaccacacagtaagccaccctcc
ccaggcctgtgctctgagactgaggacctagaccaggacttgtctgtgaaaaagtttccc
tatcaacccatgccccaggtgccagccattcagtttttcaagtccctaaagcagcaggac
tacctgtccctgcccccttgggacaatagccagcctgggaaggtgtgctga

KEGG   Mus pahari (shrew mouse): 110335025
Entry
110335025         CDS       T05929                                 

Gene name
Il2rb
Definition
(RefSeq) interleukin-2 receptor subunit beta
  KO
K05069  interleukin 2 receptor beta
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04061  Viral protein interaction with cytokine and cytokine receptor
mpah04144  Endocytosis
mpah04151  PI3K-Akt signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah05162  Measles
mpah05166  Human T-cell leukemia virus 1 infection
mpah05200  Pathways in cancer
mpah05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110335025 (Il2rb)
   04151 PI3K-Akt signaling pathway
    110335025 (Il2rb)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110335025 (Il2rb)
   04061 Viral protein interaction with cytokine and cytokine receptor
    110335025 (Il2rb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110335025 (Il2rb)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    110335025 (Il2rb)
   04659 Th17 cell differentiation
    110335025 (Il2rb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110335025 (Il2rb)
   05202 Transcriptional misregulation in cancer
    110335025 (Il2rb)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110335025 (Il2rb)
   05162 Measles
    110335025 (Il2rb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110335025 (Il2rb)
   04090 CD molecules [BR:mpah04090]
    110335025 (Il2rb)
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  IL2 receptor family
   110335025 (Il2rb)
CD molecules [BR:mpah04090]
 Proteins
  110335025 (Il2rb)
SSDB
Motif
Pfam: IL2RB_N1 fn3 Det1
Other DBs
NCBI-GeneID: 110335025
NCBI-ProteinID: XP_021072766
Ensembl: MGP_PahariEiJ_G0019987
LinkDB
Position
17
AA seq 539 aa
MAAIALSWRLALYIFLLLLATPWASAAVKDCSHLECFYNSRANVSCMWSHEEALNVTSCH
IHAKSDLRHWNKTCELTLVRQTSWACNLILGQLPDSQSLTSVDLLDISVVCWEEKGWRRV
KTCNFRPFDNLRLVAPHSLQVLHIETQRCNISWKVSQVSHYIESYLEFEARRRLLGHSWE
DASVLSLKQRQQWLFLEMLIPSTSYEVQVRVIAQRGKTRTWSPWSQPLIFRTRPADPTKE
ILPVSWLRYILLVLGCFAGFVSCVYILVKCRYLGPWLKTVLKCDIPDPSAFFSQLSSQHG
GDLQKWLSSPVPSSFFSPSGPAPEISPLEVLDRDSKAMQLLLLQKDPAPSPSPSGHSQAS
CFTNQGYFFFHLPNALEIESCQVYFTYDPCVEEDVEEDGPRLPEGSPHPPLLPLAGEQDD
YCAFPPRDDLLLFSLSLSTPNTAYGGSIAPEERPLLSLHEGLPSLTSPDLMGLQRPLGQM
LGGDGEGLSADSSEEQASVPEGSLQGQDQDRGQGPVLTLNTDAYLSLQELQAQDSVHLI
NT seq 1620 nt   +upstreamnt  +downstreamnt
atggctgccatagctctttcctggcgtctggccctctacatcttcctcctgctcctggct
acaccttgggcgtctgcagcagtgaaagactgttcccatcttgagtgcttttataactca
agagccaacgtctcctgcatgtggagccacgaagaggccctgaatgtcacatcctgccac
atccatgccaagtcggacctgcgacactggaacaaaacctgtgagctcactctcgtgagg
cagacatcctgggcctgcaacctgattctcgggcagctcccagactcccagtcactgacc
tccgtggacctcctggacataagtgtggtgtgctgggaagagaagggttggcgcagggtg
aagacctgcaacttccgtccctttgacaaccttcgcctggtggcccctcattccctccaa
gtcctgcacattgaaacccagagatgcaacataagctggaaggtctcccaggtctctcac
tacattgaatcatacttggaatttgaggcccgtagacgtcttctgggccatagctgggag
gatgcatctgtattaagcctcaagcagaggcagcagtggctcttcttggagatgcttatc
cctagcacctcctatgaggtccaggtgagggtcatagctcaacgaggcaaaaccaggacg
tggagtccctggagccagcccctgatctttcggacaagaccggcagatcccacgaaggag
attctccccgtgtcatggctcagatacattctgctggtcctcggttgtttcgctggcttc
gtctcctgcgtctacattttggtcaagtgccggtaccttgggccatggctgaagacagtt
ctcaagtgcgacatcccagatccttctgcgttcttctcccagctgagctcccagcatggg
ggagaccttcagaaatggctctcctcgcctgtcccctcgtccttcttcagccccagcggc
cctgcccctgagatctcccccctggaagtgcttgacagagactccaaggctatgcagctg
ctcctgttacagaaggaccccgccccttcgccctcgcccagtggccactcacaggccagc
tgcttcaccaaccagggctacttcttcttccatctgcccaacgccttggagattgaatcc
tgccaggtgtacttcacctatgacccctgcgtggaagaggatgtggaggaggatgggcca
aggctgcctgagggatctccccacccgcctctgctgcctctggctggagaacaggatgac
tactgtgccttccctcccagggatgacctgctgctcttctccctgagcctcagcaccccc
aacactgcctacgggggcagcatagcccctgaagaaaggcccctgctctctctgcatgag
ggacttccctccctaacatcccctgacctgatgggcttacagcgccctctggggcagatg
ctgggcggtgatggagaagggctgtctgccgatagctctgaggaacaggccagtgtcccg
gaaggcagccttcaggggcaagatcaggacagaggccagggccccgtcctgactctgaac
actgatgcctatctgtctcttcaagaactacaggcccaagattcagtccacctaatatag

KEGG   Mus pahari (shrew mouse): 110336813
Entry
110336813         CDS       T05929                                 

Gene name
Il12rb1
Definition
(RefSeq) interleukin-12 receptor subunit beta-1
  KO
K05063  interleukin 12 receptor beta-1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04630  JAK-STAT signaling pathway
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah05200  Pathways in cancer
mpah05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110336813 (Il12rb1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110336813 (Il12rb1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    110336813 (Il12rb1)
   04659 Th17 cell differentiation
    110336813 (Il12rb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110336813 (Il12rb1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    110336813 (Il12rb1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110336813 (Il12rb1)
   04090 CD molecules [BR:mpah04090]
    110336813 (Il12rb1)
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  IL6/12 receptor family
   110336813 (Il12rb1)
CD molecules [BR:mpah04090]
 Proteins
  110336813 (Il12rb1)
SSDB
Motif
Pfam: fn3 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 110336813
NCBI-ProteinID: XP_021075220
Ensembl: MGP_PahariEiJ_G0021633
LinkDB
Position
19
AA seq 738 aa
MDTMGLPGTSKHITFLLLCQLGASGPGDSCCAEKTLFPEGASGSPLGPRNLSCYRVSRTD
YECSWQYDGPEDDVSHVLWCCFVPPNHTHAGFSPECCRRFPSGSARTVQFWEQDGIPVLA
RVNFWVESRLGNRTVKSQEISQYLYNWTKTTPPLGHIRVSRSHGQLRMDWNVSEEAGTEV
QFRRRMPTTNWTLGDCGPQVNSGSGVLGDIRGSRSESCLCPSEDMAQEIQIRRRRQLSSR
APGGPWSDWSVPVCVPPEVLPQAKIKFLVEPLNQGGRRRLTMQGQLPQLAVPEGCRDRPG
AKVKKHLVLVRMLSCRCQAQTSKTVPLGKKLNLSGAAYDLDVLVETRFGRSTIQKWPLPA
QELAETRTLNVSVGGNMTTMQWAAQAPGTTYCLEWQPWGQHRNHTHCTLIAPEEEDPAKM
VTHSWSSEPTLEQEECYRITVFASKNPKNPVLWATVLSSYYFGGNASRAGTPRHVSVRNQ
TGDSVSVEWTASQLSTCPGVLMQYVVRCEAEDGAWESEWLVPPTKTQVTLDGLRSRVVYK
VQVRADTARLTGVWSHPQRFSFEVQISRLSIILASLGSFASVLLMGSLGYIGLNRAAWHL
CPPLPTPCGSTAVEFPGSQGKQAWQWCNPEDFPEVLNPRDALVVEMPGDGGDGTESPQAD
PERALDTRRPLETQRQVQGLSESRRLGLVREDWPRGDLAHVTLPLLLGGVTQGASVLDDL
WRTPKTAEPGPPTLGQEA
NT seq 2217 nt   +upstreamnt  +downstreamnt
atggacacgatggggctgccagggaccagcaagcacatcaccttcctcctgctttgccag
ctaggcgcctccggcccaggtgacagctgctgcgctgagaagacattgttcccagaggga
gcctcaggctcgcccttaggacccaggaacttgagttgctacagggtttccaggacagac
tatgagtgctcctggcagtatgatggtcctgaggatgatgtgtctcatgtcctgtggtgc
tgctttgtccctccgaaccacacccacgccggcttcagcccggagtgctgccgccgcttc
ccctcaggctcggcccgcactgtgcagttctgggaacaggacggtatccctgtgctggcc
agggtcaacttctgggtggagtctcggcttgggaaccgaaccgtgaagtcccaggagata
tcccagtacctgtacaactggaccaagaccacccctcccctgggacacatcagagtgtca
cgatcacacgggcagttgcgtatggactggaatgtgtctgaagaagctggtactgaggta
cagttcaggcgccggatgcccacaacgaattggaccttgggtgactgcggacctcaggtt
aactctggctcaggtgtgcttggggacattcgtggaagcaggtctgagtcctgcctctgc
ccttctgaggacatggcccaggagatccagatacggaggaggaggcagctctcctccaga
gcccctggaggtccctggagtgattggagcgtgcccgtgtgtgttccacctgaagtcctt
ccccaggccaagattaagttcttggtggagcccctgaaccaaggtggaaggaggcgtctg
accatgcagggacagttgccacagctggctgtcccggaaggctgccgagacaggcctggt
gcgaaggtgaagaagcacttggtgctggtgcgcatgctgtcctgcaggtgccaggctcag
acctcgaagaccgtgcccctgggcaagaaactgaacctctccggggccgcctatgacctg
gatgtgctcgtcgaaactcgtttcggtcgcagcaccatccagaagtggccccttcctgcc
caagagctcgcagagacaagaaccctgaatgtgagcgtgggaggcaacatgacaactatg
cagtgggcagcccaggctcccggcaccacctactgccttgagtggcagccatggggccag
cacaggaaccacacgcactgtaccctgattgcaccagaagaagaggaccctgccaagatg
gtgacacacagctggagctccgagcctaccctggagcaggaggaatgttaccgcatcact
gtgttcgcctccaagaaccccaagaatcccgtgctgtgggccacagtcctgtccagttac
tactttggcggtaacgcctcgagagccggtactccacgccacgtgtctgtgaggaaccaa
accggggactcggtgtccgtggagtggacggcatcacagctgagcacctgcccgggggtc
ctgatgcaatacgtcgtgcgctgcgaggctgaagacggcgcgtgggagtcagagtggctc
gtgccacccacgaaaacccaagtgacacttgacgggctgcgcagccgcgtggtgtacaag
gttcaggtgcgagctgacactgcaaggctcacgggtgtctggagccatccccagcgcttt
agctttgaggtgcagatttcccgtttatccatcattctcgcgtctctgggaagcttcgcc
agcgtcctcctcatgggcagcctcggatacattggcttaaacagggccgcctggcacttg
tgcccacccctgcctacaccctgtggcagcactgccgtggagttccctggcagccagggc
aagcaggcttggcagtggtgcaaccctgaggacttcccggaggtgttgaacccgcgagac
gcgctggtggtggagatgcccggagacggaggcgacgggacagagtcgccccaggccgac
cctgagcgcgccctggacacaaggcggcccttggagactcagaggcaggtgcagggactg
tcagagtccaggcgcctgggcctggttagggaggactggccccgtggtgacctggcccac
gtgacactcccgctgctcctgggaggtgtgacccagggagcctctgtacttgacgatctt
tggaggacccctaagactgcggagccgggaccgcccactttggggcaagaggcctga

KEGG   Mus pahari (shrew mouse): 110337661
Entry
110337661         CDS       T05929                                 

Gene name
Il27ra
Definition
(RefSeq) interleukin-27 receptor subunit alpha
  KO
K19598  interleukin 27 receptor alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04630  JAK-STAT signaling pathway
mpah04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110337661 (Il27ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110337661 (Il27ra)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    110337661 (Il27ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110337661 (Il27ra)
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  IL6/12 receptor family
   110337661 (Il27ra)
SSDB
Motif
Pfam: fn3 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 110337661
NCBI-ProteinID: XP_021076369
Ensembl: MGP_PahariEiJ_G0022893
LinkDB
Position
20
AA seq 628 aa
MSGLRVARLTPLELLLSLLPLLLGTRPYGSPGPLQCYSVGPLGILNCSWEPLGDLETPPV
LYHQSQKYHPNRVREVKVPSRQSWVTIPREQFTMADKLLIWGTQEGQPLWSPVSVNLETQ
MKPDTPQIFSQVDISEEATLEATVQWAPPVWPPQKVLICQFRYKECQAAWTQLEPQLKTD
GLTPVEMQNLESGTSYQVSGRCQVENGYPWGEWSPALSFQTPFLDPEDVWVSGTVCETSD
KRAALLVWKDPKPCVQVTYTVWFGAGDITTIQEEVPCCKSPVPAWMEWAVVSPSNSTSWA
PPTNLSLVCLAPESAPRDVGVSGPDGSPGIEVTWKQGTRKPLEYVVDWVQDGAGLDKLNW
TRVPPANLSTLLPGDFKGGVPYRITVTAVYSGGLAAAPSVWGFREELVPLAGPAVWRLPD
DPPGTPVVAWGEVPRHQLRGQATHYTFCIQSRGIPTVCRNVSSQTQTATLPNLHSGSFKL
WVMVSTVAGQGPPGPNLLIHLPDNRIRWKALPWVLSLWCLLLMGCGLSLASTRCLQARCL
HQRHKMLPQWIWDRVPDPANSNSGQPYIKEVSLPQPPREGPIVEVEEVELQPVVESPKAS
APLYSGYEKHFLPTPEELGLLRPPAPRI
NT seq 1887 nt   +upstreamnt  +downstreamnt
atgagcgggctccgggttgcacgcctcacgccgttggagcttctgctgtcgctgctaccg
ctgctgcttgggacgcggccctatggcagtccaggcccactgcagtgctacagcgtcggt
cccctgggaatcctgaactgctcctgggaacctttgggcgacctggagactccacctgtg
ctgtatcaccaaagtcagaaataccatcccaatagagtccgggaggtgaaggtgccttcc
agacagagctgggtgaccattccccgggaacagttcaccatggctgacaaacttctcatc
tggggaacacaagagggacagcctctctggtcccctgtttctgtaaacctggagacccaa
atgaagccagacaccccccagatcttctctcaagtggatatttcggaggaagcaaccctg
gaggccactgtgcagtgggcaccgcccgtgtggccaccgcagaaagttctcatctgtcag
tttcggtacaaagaatgccaggctgcatggacccagctggagccccagctgaagacagat
gggctgactcctgttgagatgcagaacctggaatctggcaccagctaccaggtgtctggc
cgctgccaggtggagaacggatatccatggggagagtggagtccggccctatccttccag
acgccattcttagatcctgaagatgtgtgggtatcggggaccgtctgtgaaacatctgac
aaacgggcagccttgcttgtctggaaggacccaaaaccttgtgtgcaggtgacttacaca
gtctggtttggggctggagatattactacaattcaagaagaggtcccgtgctgcaagtcc
cctgtccctgcatggatggagtgggctgtggtctctcctagcaacagcaccagctgggca
cctcccaccaacctgtctctggtgtgcttggctccagaatctgccccccgtgacgtggga
gtgagcggtcctgatgggagcccagggatagaggtgacctggaaacaagggaccaggaaa
ccgttggagtacgtggtggactgggttcaagatggtgccggcctggacaagctcaactgg
acccgtgtccctcctgcaaacctcagcacgttgttaccaggggatttcaaaggaggggtc
ccctatcgaattacagtgactgcagtatactctggaggattagctgctgcaccctcagtt
tggggattcagagaggaattagtaccccttgctgggccagcagtttggcgacttccagat
gaccccccagggacacctgttgtagcctggggagaagtaccaagacaccagctcagaggc
caggctactcactacaccttctgcatacagagcagaggcatccccaccgtctgcaggaac
gtgagcagtcaaacccagaccgccactctgcccaaccttcactcgggttccttcaagctg
tgggtgatggtgtccaccgttgcaggacagggcccacctggtcccaaccttttgattcac
ctaccagataataggatcaggtggaaagctctaccctgggttctgtccctgtggtgtttg
cttctgatgggctgtggcctgagcctggccagtaccaggtgcctgcaggccaggtgctta
caccagcgacacaagatgcttccccagtggatctgggacagggttcctgatcctgccaac
agcaattctgggcaaccttacatcaaggaggtgagcctgccccaaccgcccagggaagga
cccatcgtggaggtggaggaagtggagctacagcctgtcgtggagtcccctaaagcctct
gccccgctttactctgggtatgagaaacacttcctgcccacacctgaggagctgggcctt
ctgaggcctccagcccccaggatctag

KEGG   Mus pahari (shrew mouse): 110338217
Entry
110338217         CDS       T05929                                 

Gene name
Ifngr1
Definition
(RefSeq) interferon gamma receptor 1
  KO
K05132  interferon gamma receptor 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04066  HIF-1 signaling pathway
mpah04217  Necroptosis
mpah04380  Osteoclast differentiation
mpah04630  JAK-STAT signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah05140  Leishmaniasis
mpah05142  Chagas disease
mpah05145  Toxoplasmosis
mpah05152  Tuberculosis
mpah05164  Influenza A
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05200  Pathways in cancer
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mpah05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110338217 (Ifngr1)
   04066 HIF-1 signaling pathway
    110338217 (Ifngr1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110338217 (Ifngr1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110338217 (Ifngr1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110338217 (Ifngr1)
   04658 Th1 and Th2 cell differentiation
    110338217 (Ifngr1)
   04659 Th17 cell differentiation
    110338217 (Ifngr1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110338217 (Ifngr1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110338217 (Ifngr1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110338217 (Ifngr1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    110338217 (Ifngr1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110338217 (Ifngr1)
  09172 Infectious disease: viral
   05164 Influenza A
    110338217 (Ifngr1)
   05168 Herpes simplex virus 1 infection
    110338217 (Ifngr1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110338217 (Ifngr1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110338217 (Ifngr1)
   05140 Leishmaniasis
    110338217 (Ifngr1)
   05142 Chagas disease
    110338217 (Ifngr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110338217 (Ifngr1)
   04090 CD molecules [BR:mpah04090]
    110338217 (Ifngr1)
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  IFN receptor family
   110338217 (Ifngr1)
CD molecules [BR:mpah04090]
 Proteins
  110338217 (Ifngr1)
SSDB
Motif
Pfam: IFNGR1 Tissue_fac Interfer-bind MLANA Comm P33MONOX
Other DBs
NCBI-GeneID: 110338217
NCBI-ProteinID: XP_021077151
Ensembl: MGP_PahariEiJ_G0023768
LinkDB
Position
21
AA seq 490 aa
MGPQAAAGRMILLVVLMLSAKAGSGAWASTEDPEPPSVPVPTNVLIKSYNLNPIVCWEYQ
NMSQTPVFTVQVKMYPDTWTDSCINISDQCCNIYEQIMYPDVSAWARVKAKVGQKESDYA
RSEEFLMCRKGKVGPPGLEIRRKEEQLTVLVFHPEVVVNEESQGTMFGDGSTCYTFDYTV
YVEHNRSGEILHTQHTVEKEDCNETLCELNISVSTLNSRYCVSVDGLSSFWQVRTEKSKD
VCIPLFHEDEKDSIWILVVAPLIVFTVVILVFACWYIKKNSFKRKSIMLPKSLLSVVISA
KSETKPESKYSLVIPCQPSVLENETVICEERLSTVTAPDSLEAAEQEELSKETKATAAGG
STSAMTPDSPPTPIQRGSFSLLSSNQSGPCSLTTYHSRNGSDSGLVGSGSSISDSEFLPN
NNSETKMAEHDPPPVRTAPTSSGYDKPHMLVDVLVDGGGKESLIGYRLTGDVQELSQGLP
SPAGGEGTDF
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgggcccgcaggcggcagctggcaggatgattctgctggtggtcctgatgctgtctgcg
aaggccgggagtggagcttgggcgagcacggaggatcctgagccgccctcggtgcctgtc
ccgacgaatgttctaattaagtcttataacttgaaccctatcgtatgctgggaataccag
aacatgtcacagactcctgtttttactgtacaggtaaagatgtacccggatacctggact
gattcctgcatcaacatttctgatcaatgttgtaacatctatgagcaaattatgtaccct
gatgtatctgcctgggccagagttaaagctaaggttggacaaaaagaatctgactatgca
cggtcagaagagttccttatgtgccgaaagggaaaggtcggaccccctggcctggagatc
aggaggaaggaagagcagctcactgtcctcgtatttcaccccgaggtcgttgtgaatgaa
gagagccagggaaccatgtttggtgacggaagcacctgttacacattcgactatactgtg
tatgtggagcataacaggagcggggagatcctacatacacagcatacggtcgaaaaagaa
gattgtaatgaaactctgtgtgagttaaacatctcagtatccacactgaattccagatac
tgtgtttcagtagatggactctcgtctttctggcaagttagaacagaaaaatcaaaagac
gtctgtatcccccttttccatgaggatgaaaaagattcaatctggattctggtcgttgct
cctcttatcgtctttacagtagttatcctggtatttgcatgttggtatattaagaagaat
tcattcaagagaaaaagcataatgttacccaagtccttgctctctgtggtcataagtgcc
aagtcggagacaaagcctgaatcaaagtattcacttgtcataccgtgccagccatctgtc
ctagagaatgagacggtgatctgtgaagagcgcttgtccacagtgacagctccagacagc
ctggaagcagcagaacaggaagaactctcaaaagaaacaaaggctactgctgctggagga
agcacttctgccatgaccccagacagccctccaactccgatacaaagaggcagcttttcc
ctgttaagtagtaaccagtcaggcccttgtagcctcaccacctatcactccagaaatggc
tctgacagtggtctcgtgggatcgggcagctccatatctgactcggaatttctcccaaac
aacaactcggaaacaaagatggcagagcacgaccctccgcccgtgagaacggcccccacg
tcctccggttatgataaaccgcacatgttggtggacgtgcttgtggatggtggggggaag
gagtccctgattgggtatagactcacaggagatgtccaggaactgtcccaaggtctcccg
agtcctgctggtggtgaaggaactgacttttaa

KEGG   Mus pahari (shrew mouse): 110338296
Entry
110338296         CDS       T05929                                 

Gene name
Il22ra2
Definition
(RefSeq) interleukin-22 receptor subunit alpha-2 isoform X1
  KO
K05139  interleukin 22 receptor alpha 2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110338296 (Il22ra2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110338296 (Il22ra2)
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  IL10/28 receptor family
   110338296 (Il22ra2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind fn3
Other DBs
NCBI-GeneID: 110338296
NCBI-ProteinID: XP_021077264
Ensembl: MGP_PahariEiJ_G0023769
LinkDB
Position
21
AA seq 232 aa
MMPKHCLLGPLIIFLSSATALEMQPAHVPLKPQKVRFQTRNFHNILHWQPGSSLPSNGSI
YFVQYKIYGQSQWKDKVDCWGTTALFCDLTNETLDPYEQYYGRVMTASAGRHSAWTRTVR
FTPGWETKLDPPVVTITRVNASLRVLLCPPELPNRNQSGKNASVENYYGLVYRVFTINNS
LEKEQKAYEGTQRAVEIEGLIPHSSYCVVAEMYQHMFDRRSPRSKERCAQVP
NT seq 699 nt   +upstreamnt  +downstreamnt
atgatgcctaagcattgccttctaggtcccctcatcatattcttgagcagtgctacagcc
ttagaaatgcagccggctcatgtacctctgaagccccagaaggtccgatttcagaccaga
aatttccacaacattttgcactggcaaccagggagctctctccccagcaacggcagcatc
tactttgtgcagtacaagatatatggacagagccaatggaaagataaagttgactgctgg
ggtaccacagcactcttctgtgatctgactaatgaaaccttagacccatacgagcagtac
tatgggagggtgatgacagcctccgctggacgccactctgcctggaccaggacagtccgc
ttcactccagggtgggaaacaaaactagatcctccggtcgtgactataacccgagttaat
gcatctttgcgggtgcttctctgtcctccagagttgccaaatagaaaccaaagtggaaaa
aatgcatccgtggaaaattactatggcttagtataccgagttttcacaatcaacaattca
ctagagaaggagcaaaaagcctatgaaggaacccagagagctgttgaaattgaaggtctg
atacctcattccagttactgtgtagtggctgaaatgtaccagcacatgtttgacagaaga
agcccaagaagcaaggagagatgtgcgcaggttccatga

KEGG   Mus pahari (shrew mouse): 110338370
Entry
110338370         CDS       T05929                                 

Gene name
Il20ra
Definition
(RefSeq) interleukin-20 receptor subunit alpha isoform X1
  KO
K05136  interleukin 20 receptor alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04061  Viral protein interaction with cytokine and cytokine receptor
mpah04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110338370 (Il20ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110338370 (Il20ra)
   04061 Viral protein interaction with cytokine and cytokine receptor
    110338370 (Il20ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110338370 (Il20ra)
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  IL10/28 receptor family
   110338370 (Il20ra)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind fn3
Other DBs
NCBI-GeneID: 110338370
NCBI-ProteinID: XP_021077365
Ensembl: MGP_PahariEiJ_G0023771
LinkDB
Position
21
AA seq 549 aa
MNTPGTPAPGHRALPLPPPLLLATLLLLLAASGHTVPCFFHGLPKPTNITFLSINMKNVL
HWNPPEGLRGVEVTYTVQYFIYGQEKWLNASKCGSISRTYCDLSLETSDYEHQFYAKVKA
IWESRCSEWAETERFHPFLETQVSPPEVALTTGEKSISIALTAPEKWKRNPQDHTVSMQQ
IYPNLKYNVSVYNTKSRRTWSQYVTNSTLVLSSLEPNTLYCVHVESLVPGPPRLPVPSQK
QCISTLEVQTSAWKAKAIFWYVLLTSVIVFLFSAIGYSVYRYIHVGKEKHPENLVLIYRN
EIGTRVFEPTETITLNFITLSMLDDSKISPKDMNLLDKSSDDININDPERSEGWELHWEE
VEGQHLGCSSHLMDVICGAEQRDRDTSLTQHEWLNSTIPTEEADTEPQYKVLTYFYGEGE
IQQFCGPEEAARTEKICEPQATSENLDPQLEDLHHLGQEHPVSEDGPEEEPCITVVDWDP
QTGRLCIPSLPIFGRDPENYGHYETDQLLEDGLLSRLYENQAPDKLEEENEKCLMQFMEE
WGLHVQMES
NT seq 1650 nt   +upstreamnt  +downstreamnt
atgaacactcccgggaccccggcgcccggccaccgggccctgccgctgccgccgccgctg
ctgctggccacactgcttctgctgctggccgcttcgggacacacagtcccttgtttcttc
catggcttgcctaaacctacaaatatcaccttcttatctatcaacatgaagaatgtcctg
cattggaatccaccagagggtctacgtggagttgaagtcacatacactgtgcaatatttc
atatatgggcaggagaaatggctgaatgcctctaaatgcgggagtatcagcaggacctac
tgtgacctttctctcgagacctccgactatgagcaccagttctatgccaaagtgaaggcc
atttgggaaagcaggtgctccgaatgggccgagacggaacgcttccaccctttcttggaa
actcaagtcagtccaccagaggttgccctgacaactggcgagaagtccatttctattgcc
ctgacagcaccagagaagtggaaaagaaacccgcaagaccacactgtttctatgcaacag
atataccccaatttgaagtacaatgtgtctgtgtataacactaagtcgagaagaacgtgg
tcccagtatgtcaccaacagcacactggtgctcagctcgctggagcccaacactctgtat
tgtgtccacgtggagtcccttgtcccagggccccctcgcctcccggtgccttctcagaag
cagtgcatcagtactttggaagttcaaacatcagcatggaaggctaaagccatcttctgg
tatgtcttgctcacgtctgttatcgtgtttcttttctccgcaattggctactcggtttac
cgttacatccatgttggcaaggaaaaacacccagaaaatttggtactgatttatagaaat
gaaattggcacaagagtctttgaacctactgaaacaatcacacttaattttatcaccctc
agcatgttggatgattctaaaatttctccaaaggacatgaatttactggacaaaagcagt
gatgacatcaacattaatgaccctgagcgcagtgagggctgggagctgcactgggaggag
gtggaggggcaacatttaggatgctcttcgcatttgatggatgtcatctgtggtgctgag
caaagagacagagacacctctctaacccagcacgaatggcttaacagcaccatccccaca
gaagaggcagacactgagcctcaatacaaagtcctaacttacttctacggggagggtgaa
atccaacagttctgtgggccggaagaagcagccagaacagagaaaatatgtgagccacag
gcaacttcagaaaacttggacccacagcttgaagacctacatcatctggggcaggagcat
cctgtctcagaggatgggccagaggaagagccatgtataacagtagtagattgggaccct
cagactggcaggctgtgtatcccttccttgcctatctttggccgtgatcctgagaactat
gggcattatgagacagaccagctcttagaggatggccttctgtctagactgtatgagaac
caggcacctgacaagctagaggaagaaaatgaaaaatgtctcatgcagtttatggaggaa
tgggggttacatgtacaaatggaaagctag

KEGG   Mus pahari (shrew mouse): 110338645
Entry
110338645         CDS       T05929                                 

Gene name
Il11ra
Definition
(RefSeq) interleukin-11 receptor subunit alpha
  KO
K05056  interleukin 11 receptor alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04630  JAK-STAT signaling pathway
mpah04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110338645 (Il11ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110338645 (Il11ra)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110338645 (Il11ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110338645 (Il11ra)
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  IL6/12 receptor family
   110338645 (Il11ra)
SSDB
Motif
Pfam: Ig_3 ig EpoR_lig-bind
Other DBs
NCBI-GeneID: 110338645
NCBI-ProteinID: XP_021077644
Ensembl: MGP_PahariEiJ_G0024049
LinkDB
Position
22
AA seq 432 aa
MSSSCSGLTRVLVAVATALVSSSSPCPQAWGPPGVQYGQPGRPVMLCCPGVSAGTPVSWF
RDGDSRLLQGPDSGLGHRLVLAQVDSPDEGTYVCQTPDGVSGGMVTLKLGFPPARPEVSC
QAVDYENFSCTWSPGQVSGLPTRYLTSYRKKSLPGAERQRESPSTGPWPCPQDPLEASRC
VVHGAEFWSEYRINVTEVNPLGASTCLLDVRLQSILRPDPPQGLRVESVPGYPRRLHASW
TYPASWRRQPHFLLKFRLQYRPAQHPAWSTVEPIGLEEVITDAVAGLPHAVRVSARDFLD
AGTWSAWSPEAWGTPSTGPLQDEIPDWSQGHEQQLEAGVAQEDSPAPPRPSLQPDPRPLD
HRDPLEQVAVLTSLGIFSCLGLAVGALALGLWLRLRRSGKDGPQKPGFLAPMIPVEKLPG
IPNLQRTPENFS
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgagcagcagctgctcagggctgaccagggtcctggtggccgtggctacagccctggtg
tcttcctcctccccctgcccccaagcttggggtcctccaggggtccagtatggacagcct
ggcaggcccgtgatgctgtgctgccccggagtgagtgctgggactccagtgtcctggttt
cgggatggagattcaaggctgctccagggacctgactctggactaggacacagactggtc
ttggcccaggtggacagccctgacgaaggcacttacgtctgccagaccccggatggtgta
tcggggggcatggtgaccctgaagctgggcttccccccggcccgtcctgaggtctcctgc
caggcagtagactatgaaaacttctcctgtacttggagtccaggccaggtcagcggtttg
cccacccgctaccttacttcctacaggaagaagtcgctgccaggggctgagcgtcagagg
gaaagtccatccaccgggccttggccgtgtccacaggaccctctggaggcttcccgatgt
gtggtccatggggcagagttctggagtgagtaccggatcaatgtgactgaggtgaaccca
ctgggtgccagcacgtgcctactggatgtgagattacagagcatcttgcgtcctgatcca
ccccaaggactgcgggtggaatcggtacctggttacccgagacgcctgcacgccagctgg
acataccctgcctcctggcgtcgccaaccccacttcctgctcaagttccggttgcaatac
cgtccagcacagcatccagcctggtccacggtggagcccattggcttggaggaggtgata
acagatgctgtggccgggctgccccatgcggtacgagtcagtgccagggactttctggat
gctggcacgtggagcgcctggagcccagaggcttggggtactcccagcactggtcccctg
caggacgagatacctgattggagccaaggacacgaacagcagctagaggcaggagtagct
caggaggacagcccggctcctccaaggccttccttgcagccagacccaaggccacttgat
cacagggaccccttggagcaagtggctgtgttaacatctctgggaatcttctcatgcctt
ggcctggctgttggagccctggcactggggctctggctgaggttgagacggagtgggaag
gatggaccgcaaaaacctgggttcttggcccccatgatcccggtggaaaagcttccagga
attccaaacctgcagaggaccccggagaacttcagctga

KEGG   Mus pahari (shrew mouse): 110338678
Entry
110338678         CDS       T05929                                 

Gene name
Cntfr
Definition
(RefSeq) ciliary neurotrophic factor receptor subunit alpha
  KO
K05059  ciliary neurotrophic factor receptor
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110338678 (Cntfr)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110338678 (Cntfr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110338678 (Cntfr)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
    110338678 (Cntfr)
Cytokine receptors [BR:mpah04050]
 Interleukin receptor families
  IL6/12 receptor family
   110338678 (Cntfr)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
 Receptors
  110338678 (Cntfr)
SSDB
Motif
Pfam: fn3 Ig_3 Ig_2 ig Ig_5
Other DBs
NCBI-GeneID: 110338678
NCBI-ProteinID: XP_021077722
Ensembl: MGP_PahariEiJ_G0024042
LinkDB
Position
22
AA seq 372 aa
MAASVPWACCAVLAAAAAAVYTQKHSPQEAPHVQYERLGADVTLPCGTASWDAAVTWRVN
GTDLAPDLLNGSQLILRSLELGHSGLYACFHRDSWHLHHQVLLHVGLPPREPVLSCRSNT
YPKGFYCSWHLPTPTYIPNTFNVTVLHGSKIMVCEKDPALKNRCHIRYMHLFSTIKYKVS
ISVSNALGHNTTAITFDEFTIVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFPL
KFFLRYRPLILDQWQHVELSDGTAHTITDAYAGKEYIIQVAAKDNEIGTWSDWSVAAHAT
PWTEEPRHLTTEAQAPETTTSTTSSLAPPPTTKICDPGELGSGGGPSIPFMTSVPVTLVL
AAAAATASNLLI
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggctgcttctgtcccatgggcctgctgtgctgtgcttgccgctgccgctgctgctgtc
tacacgcagaaacacagtccacaggaggcaccccacgtgcagtacgagcgtctgggcgca
gatgtgacgctgccctgtgggacagcgagctgggacgcagctgtaacatggagggtaaac
gggacagatctggcccctgacctgctcaacggctctcagctgatactgcgaagcttagaa
ctgggccacagtggcctgtacgcctgtttccaccgtgactcctggcacctgcaccaccaa
gtccttctacatgtgggtttgccgccgcgggagcctgtgctcagctgccgctccaacact
taccccaagggcttctactgcagctggcacctgcccacccccacctacatccccaatacc
ttcaatgtgactgtgctgcatggctccaaaattatggtctgtgagaaggacccagccctc
aagaaccgctgccacattcggtacatgcacctgttctcaaccatcaagtacaaggtctcc
ataagtgtcagcaatgctttgggtcacaacactacggccatcacctttgacgaattcacc
attgtgaagcctgaccctccagaaaatgtggtggcccggccagtgcccagcaacccccgt
cggctggaggtgacgtggcagacgccctcaacttggccggaccccgaatcctttcctctc
aagttcttcctgcgctaccggcctctcatcctggaccagtggcagcatgtggagctctcg
gatggcacagcgcacaccatcacagatgcctacgcagggaaggaatacatcatccaggtg
gcagccaaggacaatgagattgggacgtggagtgactggagcgtggctgctcacgccacg
ccttggactgaggaacctcggcatctcaccacagaagcccaggcccccgagaccacgacc
agcaccaccagctcattggcacccccacccaccacgaagatctgtgaccctggggagctc
ggcagcggcggaggaccctccatacccttcatgaccagtgtccctgtcactctggtcctg
gctgccgctgctgccacagccagcaatctcctgatctga

DBGET integrated database retrieval system