KEGG   Mus pahari (shrew mouse): 110314132
Entry
110314132         CDS       T05929                                 

Gene name
Dlg3
Definition
(RefSeq) disks large homolog 3 isoform X1
  KO
K21098  discs large protein 3
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04390  Hippo signaling pathway
mpah04530  Tight junction
mpah05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110314132 (Dlg3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110314132 (Dlg3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110314132 (Dlg3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mpah01009]
    110314132 (Dlg3)
Protein phosphatases and associated proteins [BR:mpah01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110314132 (Dlg3)
SSDB
Motif
Pfam: Guanylate_kin PDZ PDZ_assoc PDZ_6 PDZ_2 MAGUK_N_PEST SH3_1 SH3_2 SH3_9 DUF6288
Other DBs
NCBI-GeneID: 110314132
NCBI-ProteinID: XP_021044252
Ensembl: MGP_PahariEiJ_G0031814
LinkDB
Position
X
AA seq 849 aa
MHKHQHCCKCPECYEVTRLAALRRLEPPGYGDWQVPDPYGPSGGNGASSGYGGYSSQTLP
SQAGATPTPRTKAKLIPTGRDVGPVPPKPVPGKSTPKLNGSGPGWWPECTCTNRDWYEQA
SPAPLLVNPEALEPSLSVNGSDGMFKYEEIVLERGNSGLGFSIAGGIDNPHVPDDPGIFI
TKIIPGGAAAMDGRLGVNDCVLRVNEVDVSEVVHSRAVEALKEAGPVVRLVVRRRQPPPE
TIMEVNLLKGPKGLGFSIAGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQIGDRLLAVN
NTNLQDVRHEEAVASLKNTSDMVYLKVAKPGSIHLNDMYAPPDYASTFTALADNHISHNS
SLGYLGAVESKVTYPAPPQVPPTRYSPIPRHMLAEDDFTREPRKIILHKGSTGLGFNIVG
GEDGEGIFVSFILAGGPADLSGELRRGDRILSVNGVNLRNATHEQAAAALKRAGQSVTIV
AQYRPEEYSRFESKIHDLREQMMNSSMSSGSGSLRTSEKRSLYVRALFDYDRTRDSCLPS
QGLSFSYGDILHVINASDDEWWQARLVTPHGESEQIGVVPSKKRVEKKERARLKTVKFHA
RTGMIESNRDFPGLSDDYYGAKNLKGVTSNTSDSESSSKGQEDAILSYEPVTRQEIHYAR
PVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQD
NKFIEAGQFNDNLYGTSIQSVRAVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSI
EALMEMNRRQTYEQANKMFDKAMKLEQEFGEYFTAIVQGDSLEEIYNKIKQIIEDQSGHY
IWVPSPEKL
NT seq 2550 nt   +upstreamnt  +downstreamnt
atgcacaagcaccagcactgctgtaagtgccccgagtgctatgaggtgacccgcctggcc
gccctgcggcgtcttgagcctcctggctacggggactggcaggtgccggacccctatggg
ccaagtgggggcaatggggccagctcaggttatggaggctacagctcgcagaccctgcct
tcacaggcaggggctacccccacccctcgcaccaaggccaagctcatccccacaggccga
gatgtggggccagtgccccctaagccagtccccggcaagagtaccccaaaactcaacggc
agtggccccggctggtggcccgagtgcacctgtaccaaccgggactggtatgagcaggcc
agccctgcacccctcctagtgaaccccgaggccctggagcccagcctatcggtgaatggc
agtgatggcatgttcaaatatgaggagatagtactggagcggggcaactctggcctgggc
ttcagtatcgcaggtggcatcgacaaccctcatgtccctgatgaccctggcatctttatt
accaagatcattcctggtggagcagctgccatggatgggaggctgggggtgaatgactgt
gtgctacgggtgaatgaggtggatgtgtccgaggtggtgcacagccgggccgtggaggca
ctgaaggaggcaggccctgtggtgcggttggtggtgcggaggcgacagcccccacctgag
actatcatggaggtcaacctgctcaaagggccaaaaggcctaggtttcagcattgctggg
ggcattggcaaccagcacatcccaggagacaacagcatctatatcaccaagatcattgaa
ggaggagctgctcagaaggatggacgcctacagattggggaccggctgcttgcggtgaac
aataccaatctgcaggacgtgaggcatgaggaagctgtggcttcgctcaagaacacatca
gacatggtctatctgaaggtggccaagccaggcagcatccacctcaacgatatgtatgct
ccccctgactatgccagcactttcactgccttggctgacaatcacataagccataattcc
agcctgggttatcttggggcagtggagagcaaggtcacctacccagctcctcctcaggtg
ccccctactcgttactctcctattcccagacacatgctggctgaggacgactttaccaga
gagccccgcaagatcatcctgcacaaaggttctacaggtctgggcttcaacattgtagga
ggagaagatggagaaggcatttttgtttccttcatcctggcaggaggcccagcagaccta
agtggggagttgcgaaggggagaccggatcttatcggtaaatggagtcaacctgaggaat
gctacccatgagcaggcagcggctgctctgaaacgggctggccagtcagtcaccattgtg
gcccagtatagacctgaagagtacagtcgctttgaatccaagatccatgacttgcgggaa
caaatgatgaacagcagcatgagttctgggtctgggtctctccgaaccagtgagaagagg
tccttgtatgtcagggccctgtttgattatgatcggactcgtgacagctgcctaccaagc
cagggactcagtttttcttatggtgacattctgcacgtcatcaacgcctctgatgatgag
tggtggcaagcaaggctggtgactcctcatggggagagtgaacagattggtgtggtcccg
agtaagaagagggtggaaaagaaagagcgagctcgattgaaaactgtgaagttccatgcc
aggacagggatgattgagtctaatcgggacttccctgggttaagtgacgattattatgga
gcaaagaacctgaagggagtgacatccaacaccagtgacagcgaaagcagttccaaagga
caagaggatgctattttgtcatatgagccagtgacacgacaagaaattcactatgccagg
cctgtgatcatcttgggcccaatgaaggaccgagtcaatgatgacctcatctctgagttc
ccgcataaatttggatcctgtgtgccacataccacccggcctcggcgtgataacgaggta
gatggacaggattaccactttgtggtttcccgggaacagatggagaaggatattcaggac
aacaagttcattgaggcgggccagttcaatgataatctctatgggaccagcatccagtct
gtgcgggcagttgcagagaggggcaagcactgcatcttagatgtctccggcaatgccata
aagagactgcagcaagcacaactttaccccattgccattttcatcaagcccaagtccatc
gaagcacttatggaaatgaaccgacggcagacatatgagcaagcaaataagatgtttgat
aaagccatgaaactggagcaagaatttggagaatactttacagccattgtacagggtgac
tcactggaagagatttataacaaaatcaaacaaatcattgaggaccagtctgggcactac
atttgggtcccatcccctgaaaaactctga

KEGG   Mus pahari (shrew mouse): 110325828
Entry
110325828         CDS       T05929                                 

Gene name
Dlg5
Definition
(RefSeq) disks large homolog 5 isoform X1
  KO
K24050  discs large protein 5
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110325828 (Dlg5)
SSDB
Motif
Pfam: PDZ PDZ_6 Takusan dbPDZ_assoc PDZ_2 Guanylate_kin DUF6288 SH3_2
Other DBs
NCBI-GeneID: 110325828
NCBI-ProteinID: XP_021059620
Ensembl: MGP_PahariEiJ_G0030028
LinkDB
Position
8
AA seq 1920 aa
MEPQRRELLAQCQQSLAQAMTEVEAVLGLLEAAGALSPGERRQLDEEAGGAKAELLLQLL
LAKEQDHFQDLRAALEKTQPHLLPILYLNGVVGPPQSTEGAGSTYSVLSIMPSDSESSSS
LSSVGTTGKAPSPPPLLSEQQASDTVANLSIQLRLMTRERNELRKRLAFATHGATFDKRP
YHRLNPDYERLKIQCVRAMSDLQSLQNQHTNALKRCEEVAKETDFYHTLHSRLLSDQTQL
KDDVDMLRRENGKLRRERNLLQQSWEDMKRLREEDQKELGDLRAQQQQVLKHNGSSEILN
KLYDTAMDKLEVVKKDYDALRKRYSEKVALHNSDLSRLEQLGEENERLQKQTETLTQQRD
TAIQLQHQCALSLRRFETIHHELSKATAQNKDLQWEMELLQSELTELRSKQVKTAKESEK
YKEERDAVFSEYKLIMSERDQVISELDKLQTEVELAESKLKSSTSEKKAASEEMEALRQI
KDTVTMDAGRANKEVEILRKQCKALCQELKEALQEADVAKCRRDWAFQERDKIVAERDSI
RTLCDNLRRERDRAVSELAEALRSLDDTRKQKNDVSRELKELKEQMECQLEKEARFRQLM
AHSSHDSAIDTDSMEWETEVVEFERETEDIDLKALGFDMAEGVNEPCFPGDCGIFVTKVD
KGSIADGRLRVNDWLLRINDVDLINKDKKQAIKALLNGEGAINMVVRRRKSLGGKVVTPL
HINLSGQKDSGISLENGVYAAAVVPGSPAAKEGSLAVGDRIVAINGIALDNKSLNECESL
LRSCQDSLTLSLLKVFPQSTSWSGQNIFENIKDSDRMLSCRAHGPEVQAHNKRNLLQHNN
STQTDIFYTDQLEDRKELGHSGGSSSFLHKPFSGSSSPASPQACPSTSERSLNSFRSDTS
AERGYGLVDVQNQRPVLSFETEVGPCVAVEVPLDKIDPEGSNSSGTWPKAVLGSTSGPEK
LSVYKKPKQRKSIFDPNTFKRPQTPPKIDYLLPGPGLTHSPQPSKRVGSLTPPKPPRRSD
SIKFQHRLETSSESEATLVGSSPSTSPPSAPPPSMDPSEPTHASPPRKARVRIASSYHSE
GDGDTYLPAKKPCDEDLASQKVDELGQKRRRPKSAPSFRPKISPVAIPAQCLEEQEYVPA
SGELSPEGQEWSPYSPGQASRHGNPLLYPNRPSVGTVPRSMTPGTTVGSILRNPIYTVRS
HRVLPCSSPPVPRDAGSQSLSPSVQHQGRLSLDLSHRACSDYSEMRASQGSNSLPSSARL
GSSSNLQFKAERIKIPLTPRYPRSVMGSDRGSLSHSECSTPPRSPLNIDTLSSCSQPQSA
ASTLPRIAVNPSSHGERRKDRPFVEEPRHVKVQKGSEPLGISIVSGEKGGIYVSKVTMGS
IAHQAGLEYGDQLLEFNGINLRSATEQQARLIIGQQCDTITILAQYNPHIHQLNSHSRSS
SHLDPAAASHSILQGSSAATPEHPSVIDPLMEQDEGPGTPPAKQSASSSRTVGDTSKKPP
DPRIVFIKKSQLDLGVHVCGGNLHGVFVAEVEDDSPAKGPDGLVPGDLILEYGNLDMRSR
TVEDVYVEMLKPKDSIRLKVQYRHEEFTRVKGLPGDSFYIRALYDRLAEVEPELSFKKDD
ILYVDDTLPQGMFGSWMAWQLDENAQKIQRGQIPSKYVMDQEFSRRLSMSEVKDDNTAKT
LSAAARRSFFRRKHKHKRSGSKDGKDLLALDTFSNDSIPLFEDSVSLAYQRVQKVDCTSL
RPVLILGPLLDVVKEMLVNEAPGKFCRCPLEVMKASQQAIERGVKDCLFVDYKRRSGHFD
VTTVASIKEITEKNRHCLLDIAPHAIERLHHMHIYPIVIFIRYKSAKHIKEQRDPVYLRD
KVTQRHSKEQFETAQKIDQEYSRYFTGVVQGGALSSICTQILAMVSQEQNKVLWIPACPP
NT seq 5763 nt   +upstreamnt  +downstreamnt
atggagccgcagcgccgggagctgctcgcccagtgtcagcagagcctggcccaggccatg
accgaggtggaggccgtgctcgggctgctggaggcagcaggagcgctgagccccggcgag
cggcggcagctggacgaggaggcgggaggcgccaaggcggagctgctgctccagctactc
ctggccaaggagcaggaccacttccaggacctgcgcgccgcgctggagaagactcagcct
cacctgctgcctattctctacctgaacggcgtcgtcgggccgccgcagtctacagagggc
gcggggtccacctacagcgtcctgtccatcatgccctcagactcggagagcagcagctcc
ctcagcagtgtggggactactggaaaggcaccgtccccaccacccctcctctccgagcag
caggccagtgacacggtggcgaacctctccattcagctaaggttgatgacccgtgagagg
aatgagctacgcaagcgcctggccttcgccacccatggagccacctttgacaaaaggccc
taccacaggctgaatcctgattatgagaggctaaagatccagtgtgtgcgggccatgtcg
gacctgcagagcttacagaaccagcacaccaacgccttgaagaggtgcgaggaggtggcc
aaggagacagacttctatcacaccctccacagccggctcctgagtgaccagacacagctg
aaggatgacgtggacatgctgagacgggagaacgggaagctgcggagggagcggaacctg
ctgcagcagtcctgggaggacatgaagcggctcagggaggaggaccagaaggagttaggt
gacctccgggcccagcagcagcaggtgctgaagcacaatggctcgtcagagatcctcaac
aagctgtacgatacggccatggacaagctggaggtagtcaagaaggactacgatgctctg
cggaagaggtacagcgagaaggttgccctgcacaactcggacctgagccgcctggagcag
cttggggaggagaacgagcgcctgcaaaagcagacggagacgctgacccagcagagggac
acggccattcagttacaacaccagtgtgctctctccctgaggaggtttgagacgatccac
catgagctgagcaaggccacagcccagaacaaggacctgcagtgggagatggagctgctg
caatccgagctcacggagctgaggagcaagcaggtgaaaactgccaaggagtcagagaaa
tacaaggaggagcgcgatgctgtgttcagcgagtacaagctcatcatgagcgagcgcgac
caggtcatctctgagctggacaagctacagacagaggtagagctggccgagtccaagctc
aagagcagcacatccgagaagaaggcagccagcgaggagatggaggccctgcggcagatc
aaagacacagtgaccatggatgctgggagagccaacaaagaagtggaaatcctccgaaaa
cagtgtaaggccttgtgccaggagctgaaggaagctctccaggaagcagacgtggccaag
tgccggcgggactgggcctttcaggagcgggacaagattgtggcagagcgtgacagcatc
cggaccctgtgtgacaacctgaggcgggagcgagatcgagctgtgagtgagctggctgaa
gcccttcgtagcctggatgacactcggaagcagaagaatgacgtcagccgggaactcaag
gagctcaaggagcagatggaatgccagctggagaaggaggctcggttccggcagctgatg
gcccacagttcccacgactcagccatcgacacagattccatggagtgggagacagaagtt
gtggaatttgagagagagacggaggatattgacttgaaagcacttgggtttgacatggca
gaaggtgtgaatgagccttgtttcccaggggattgtggcatatttgttacaaaagtggat
aaaggaagcattgctgatggtcgcttaagggtcaacgactggctgctgagaatcaacgac
gtggacctcatcaacaaggacaagaaacaggccatcaaggcactcctcaatggagaagga
gccatcaacatggttgtgaggaggaggaagtccctgggtgggaaggtcgtcacacctctg
catatcaacctcagtggacagaaagacagtggcatcagtttggagaatggagtgtatgcc
gccgcagtggtgcctggaagcccggctgccaaagaggggtccctcgccgtgggagacagg
attgttgcgatcaacggtattgcactggacaataagtccctgaatgaatgtgaatctctg
ctgcgcagctgtcaagactccttgaccctctccctcctgaaggtgtttccgcagagcacc
tcatggagcggccagaacatctttgaaaatatcaaggactcagataggatgctgagttgc
cgagcccatggcccagaggtccaggcgcataacaaacggaacttgttacagcacaataat
tccacgcagacggacattttctacactgatcagctggaggaccggaaggagctggggcat
tctggaggcagcagttcttttctgcacaagcccttctctggctcctcctctccagcctcc
cctcaggcctgtcccagcacctctgagcgtagtctgaactcattccgctctgatacctct
gcagaacgtggctatgggctggtggacgtgcagaaccagcggccagtgctgtcttttgag
actgaggtgggcccctgtgtggcagtagaggttcccctggacaagatagatccagagggc
tccaatagtagtgggacctggcctaaggctgtgctcggctccacatcagggcctgagaaa
ctctctgtgtataagaaacccaaacaaaggaagtccatctttgacccaaatactttcaag
cgcccacagacaccccccaaaatagactacctgcttccaggccctgggcttactcactcc
ccccagccctccaagagggtagggtctctgacacccccaaaaccccccaggagaagtgac
tctatcaagttccaacacaggctggagaccagttctgagtcagaggccactttggtgggc
agctcaccttccaccagcccccccagtgccccaccccccagcatggaccccagcgagccc
acgcatgcttcacctcctcggaaggccagggtccgcatcgcctccagctaccactctgaa
ggggacggagacacctacctgcccgccaagaagccctgtgatgaagaccttgcctcccag
aaagtcgacgagctggggcagaaacgtcgccggccaaagtctgcccccagttttcggccc
aagatctctccagtggcgatccctgctcagtgcctggaggaacaggagtatgttccagcc
agcggagagctctccccagagggtcaggaatggtccccgtactcaccagggcaagctagc
cggcatggcaaccccctactctaccccaaccggccatctgtgggcactgttccccggagt
atgacccccggcaccactgtgggctccattctgaggaaccccatttatactgtgcgcagc
cacagggtgcttccctgcagctcgccacccgtgccccgtgatgctggctcccagagcttg
tctcccagtgtccagcatcagggacgcctcagcctggacctgagccacagggcctgcagt
gactactctgagatgcgagcctcccagggttccaactctctgccctccagtgcccgcctt
ggctcttccagtaacctgcagttcaaggctgagcggattaagatcccgttaacaccaaga
tatccccggtctgtcatgggctctgacagaggctcactgtcacattctgaatgtagcact
cctccccggtccccgctgaatatcgataccctgtcctcctgtagtcagcctcagagcgca
gcctccactttacccaggattgcggtcaatccctcttcccatggggagcggaggaaggac
aggcctttcgtggaagagccacgccacgtgaaggtgcagaagggttcagagcctctgggc
atctccatcgtgagtggagaaaagggcggtatctatgtctccaaggtgaccatggggagc
atcgcccaccaagctggacttgagtatggggaccagttacttgagttcaatggcataaac
ctgaggagcgccaccgagcagcaggcccggctcatcatcggacagcagtgtgacaccatc
accatcctggcccagtacaacccacacattcaccagctcaacagccactcccgctccagc
tctcacctggacccagctgccgcctctcactctattctccagggcagcagtgctgcgacc
ccagaacatccctctgtcatcgatccactgatggaacaggatgaaggccctggcaccccc
ccagccaagcaaagtgcctccagctccaggactgtgggagataccagcaagaagccccct
gatccccgcattgttttcatcaagaaatcccagctggatctgggagtgcacgtgtgtggt
gggaacctgcatggagtgtttgtggccgaggtggaagatgacagtcccgccaagggtcct
gatggtctcgtgccaggcgacctcatccttgagtatggcaacctggatatgcgcagcagg
acggtggaggatgtctatgtggagatgttgaagcccaaggatagcatccgcctgaaggtg
cagtaccgccatgaggagttcaccagggtcaagggcctgccaggagacagcttctacatc
agggccctatatgaccgtctggcagaggtggagcctgaactgagttttaagaaagatgac
atcctgtatgtggatgatacgttgccccagggcatgtttgggtcctggatggcctggcag
ctggatgagaatgcccagaagatccagcgtgggcagattcccagcaaatacgtgatggac
caagagttctccaggaggctcagcatgtccgaggtcaaagatgacaacacagccaagaca
ctgtcggcagctgcacgccgctccttcttccgaaggaaacataaacacaaacgcagtggg
tccaaagatggcaaggacctgcttgccctggacaccttttccaacgactccattcctctc
tttgaagactcggtgagcctggcctatcagcgggtccagaaagtggactgcacctctctt
cggcctgttctcatcctgggacctttactggatgtggtgaaagagatgctggtgaacgag
gcacccggcaagttctgcagatgcccacttgaggtgatgaaggcctcccagcaagctatt
gagcggggtgtcaaagactgcctgtttgtggactacaagcggaggagtggccattttgat
gttactactgtggcttcaataaaggagatcacagaaaagaatcggcactgtcttctggac
atcgccccacatgccatcgagaggctgcaccacatgcacatctaccccattgtcatcttc
atccgctacaagagcgccaagcacatcaaggaacagagggaccctgtctacctgagggac
aaggtgacacagaggcattccaaagagcaattcgaaacagcacagaagatcgatcaggag
tacagcaggtacttcacaggggtcgtccagggtggagccctgtccagcatttgcactcag
atcctggccatggtcagtcaagagcaaaataaagtcctgtggatcccggcttgcccaccc
tag

KEGG   Mus pahari (shrew mouse): 110329715
Entry
110329715         CDS       T05929                                 

Gene name
Dlg1
Definition
(RefSeq) disks large homolog 1 isoform X1
  KO
K12076  disks large protein 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04390  Hippo signaling pathway
mpah04530  Tight junction
mpah04660  T cell receptor signaling pathway
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110329715 (Dlg1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110329715 (Dlg1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    110329715 (Dlg1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110329715 (Dlg1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110329715 (Dlg1)
   05165 Human papillomavirus infection
    110329715 (Dlg1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mpah03036]
    110329715 (Dlg1)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    110329715 (Dlg1)
SSDB
Motif
Pfam: Guanylate_kin PDZ MAGUK_N_PEST L27_1 PDZ_6 PDZ_assoc PDZ_2 SH3_1 SH3_2 SH3_9 DUF1638
Other DBs
NCBI-GeneID: 110329715
NCBI-ProteinID: XP_021065181
Ensembl: MGP_PahariEiJ_G0016359
LinkDB
Position
12
AA seq 927 aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTL
LDNPKCVDHSKQCEPVQPVSTWEIASLPSTAVTSETLPSSLSPPVEKYRYQDEEVLPPEH
MSPQVTNEVLGPELVHVSEKNLSEIENVHGFVSHSHISPIKPTEAVPPSSPIVPVTPALP
VPAESTVVLPSAPQANPPPVLVNTDSLETPTYVNGTDADYEYEEITLERGNSGLGFSIAG
GTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEADVRDVTHSKAVEALKEAG
SIVRLYVKRRKPASEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAH
KDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSLYINDGYAPPDIT
NSSSQSVDNHVSPSSYLGQTPTSPARYSPISKAVLGDDEITREPRKVVLHRGSTGLGFNI
VGGEDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVT
IVAQYRPEEYSRFEAKIHDLREQMMNSSVSSGSGSLRTSQKRSLYVRALFDYDKTKDSGL
PSQGLNFRFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERARLKTVKF
NSKTRGDKGQSFNDKRKKNLFSRKFPFYKNKDQSEQETSDADQHVTSNASDSESSYRGQE
EYVLSYEPVNQQEVNYTRPVIILGPMKDRVNDDLISEFPDKFGSCVPHTTRPKRDYEVDG
RDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVRAVAEKGKHCILDVSGNAIKR
LQIAQLYPISIFIKPKSMENIMEMNKRLTEEQAKKTFERAMKLEQEFTEHFTAIVQGDTL
EDIYNQVKQIIEEQSGPYIWVPAKEKL
NT seq 2784 nt   +upstreamnt  +downstreamnt
atgccggtccggaagcaagatacccagagagcattgcatctgttggaagaatatcgatcg
aaactaagccaaactgaagacagacagctcagaagttccatagagcgggttattaacata
tttcagagcaacctctttcaggctttaatagatattcaagaattttatgaagtgacctta
cttgataatccaaaatgtgtggatcattcaaagcagtgtgaaccagttcagcctgtgagt
acttgggagattgccagccttcctagcactgccgtgacgtcagaaaccctgcccagcagc
cttagccctccagtagagaaataccggtatcaggatgaagaggtacttcctccagagcat
atgtccccacaagtcacaaatgaggtgctaggtccagaattggttcatgtctcagagaag
aacctgtcagagattgagaatgtccacggatttgtttctcattctcatatttcaccaata
aagcccacagaagctgttcctccctcctctcccattgtccctgtgacccctgccctgcca
gtccctgcagagagtactgtcgtcctgccctccgcaccacaggcaaatcctcctccagtg
ctggtcaacacagacagcttagagacaccaacttatgttaatggcactgatgcagattat
gaatatgaggaaatcacacttgaaaggggaaattcaggtcttggtttcagcattgcagga
ggtacagacaacccacacattggagatgactcaagtattttcatcaccaaaattatcaca
ggcggagcagctgcccaggatggaagattgcgggtaaatgactgtatactgagagtaaat
gaagcagacgttcgtgatgtaacccacagcaaagcagtggaggcattaaaagaagctgga
tctattgtgcgattatatgtgaaaaggcggaagccagcatcagaaaaaatcatggaaata
aaactcattaaaggtcctaaaggtcttgggttcagcattgctggaggtgttggaaatcag
cacattcctggtgacaacagcatctatgtaaccaaaataattgaaggaggtgcagcacac
aaggatggcaagcttcagattggagataagcttctagcagtaaacagtgtgtgtttagaa
gaagttactcatgaagaagcagtgactgccttaaagaatacatctgattttgtttatttg
aaagtggcaaaaccaacaagtctgtatataaatgatggctatgcaccacctgacatcact
aattcttcttctcaatctgttgacaaccatgttagcccgtcttcatacttgggccagacg
ccaacatcaccagccagatactcacccatttcgaaagccgtgctcggagatgatgagatc
actagggaacctagaaaagttgttcttcatcgtggctcaacaggacttggtttcaacatt
gtgggaggtgaagatggagaagggatttttatctccttcatccttgctggcggacctgct
gatctaagtggagagctcagaaaaggagatcgcatcatatcggtaaacagtgttgacctc
agagctgcaagtcatgaacaagcagcagctgcattaaaaaatgcaggccaagccgtcact
atcgttgcacagtatcgacccgaagagtacagtcgttttgaagctaaaattcatgactta
cgggagcagatgatgaacagcagtgtcagttcagggtcagggtctcttcgaaccagccag
aagcggtccctctatgtcagagccctttttgattatgacaagactaaagacagtggactt
cccagtcaaggattgaacttcagatttggagatattctccatgttatcaatgcttctgat
gatgagtggtggcaagccagacaggtcaccccagatggagagagtgacgaagttggagtg
attcctagtaaacgcagagttgagaagaaagaacgcgcccgattaaaaacagtcaaattc
aattctaaaacaagaggagataaagggcagtcattcaatgacaagcgtaaaaagaacctc
ttttcccgaaaattccccttctacaagaacaaggaccagagtgagcaggaaacgagtgat
gctgaccagcatgtaacttctaatgccagcgatagtgaaagtagttaccgtggtcaagaa
gaatatgttttatcttatgagccagtgaatcaacaagaagttaattatacccgaccagtc
atcatattaggacctatgaaagacagagtaaatgatgacttaatctcagaatttcctgac
aaatttggatcctgtgtccctcatacaactagaccaaagcgtgactatgaggtggatgga
agagattatcattttgtgacttcaagagaacagatggagaaggatatccaagagcataaa
ttcattgaagctggccagtataacaaccacctatatgggacgagcgttcagtctgtgcga
gcagtggcagagaagggcaaacattgtatccttgatgtgtctggaaatgccataaagagg
ttgcagattgcacagctttatccaatatctatttttattaaacccaaatccatggaaaat
atcatggaaatgaacaagcgcctaacagaagagcaggccaaaaaaacatttgagagagcc
atgaagctggagcaggagttcactgagcatttcacagctattgtacagggggacacgctg
gaggacatttacaaccaagtgaagcagatcatcgaggagcagtctgggccttacatctgg
gtcccagcgaaagagaagctatga

KEGG   Mus pahari (shrew mouse): 110332219
Entry
110332219         CDS       T05929                                 

Gene name
Dlg4
Definition
(RefSeq) disks large homolog 4 isoform X1
  KO
K11828  discs large protein 4
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04390  Hippo signaling pathway
mpah04724  Glutamatergic synapse
mpah05016  Huntington disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05030  Cocaine addiction
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110332219 (Dlg4)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    110332219 (Dlg4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    110332219 (Dlg4)
   05022 Pathways of neurodegeneration - multiple diseases
    110332219 (Dlg4)
  09165 Substance dependence
   05030 Cocaine addiction
    110332219 (Dlg4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110332219 (Dlg4)
Membrane trafficking [BR:mpah04131]
 SNARE
  SNARE associated proteins
   Others
    110332219 (Dlg4)
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    110332219 (Dlg4)
SSDB
Motif
Pfam: Guanylate_kin PDZ PDZ_assoc PDZ_6 PDZ_2 MAGUK_N_PEST SH3_1 SH3_2 L27_1 DUF6288 SH3_9
Other DBs
NCBI-GeneID: 110332219
NCBI-ProteinID: XP_021068973
Ensembl: MGP_PahariEiJ_G0017746
LinkDB
Position
14
AA seq 764 aa
MSQRPRAPRSALWLLAPPLLRWAPPLLTVLHSDLFQALLDILDYYETCISESQKYRYQDE
DTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYVNGTEGEMEYEEITLERGNSGLGFSIA
GGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEA
GSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAA
HKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVYLKVAKPSNAYLSDSYAPPDI
TTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKDLLGEEDIPREPRRIVIHRGS
TGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALK
NAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYD
KTKDCGFLSQALSFHFGDVLHVIDASDEEWWQARRVHSDSETDDIGFIPSKRRVERREWS
RLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIILGPTKDRANDDLLSEFPDKFG
SCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVA
EQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKL
EQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPARERL
NT seq 2295 nt   +upstreamnt  +downstreamnt
atgtcccagagaccaagagctcccaggtcagccctctggctcctggcccccccactactg
cggtgggcaccccccctcctcacagtgctgcacagtgacctcttccaggccttgctggac
atcctggactattatgagacttgtatctcagagagtcagaaataccgctaccaagatgaa
gacacgccccctctggaacacagcccggcccacctccccaaccaggccaattctccccct
gtgattgtcaacacggacaccctagaagccccaggatatgtgaacggaacagagggggag
atggagtatgaggagatcacattggaaaggggtaactcaggtctgggcttcagcatcgca
ggtggcaccgacaacccgcacatcggtgacgacccatccatctttatcaccaagatcatt
cctggtggggctgcagcccaggatggccgcctcagggtcaacgacagcatcctgtttgtc
aatgaagtggatgtccgggaggtgacccattcggctgcggtggaggccctcaaagaggcg
ggttccatcgttcgtctctacgtcatgcgccggaaacccccagctgaaaaggtcatggag
atcaagctcatcaaagggcctaaaggacttggcttcagcatcgcagggggcgttgggaat
cagcacatccctggagacaatagcatctacgtaacgaagatcatcgaaggaggtgctgcc
cacaaggatggcaggttgcagattggcgacaagatcctggcggtcaacagtgtggggcta
gaggatgtcatgcacgaggacgccgtggcagccctgaagaacacatatgacgttgtgtac
ctaaaggtggccaagcccagcaatgcctacctgagtgacagctatgctcccccagacatc
acaacctcatattctcagcacctggacaatgagatcagtcatagcagctacttgggcacc
gactaccccacagccatgacccccacttcccctcggcgctactcccccgtggccaaggac
ctgctaggggaggaagacattccccgggaaccaaggcggatcgtgatccatcggggctcc
acgggcctgggcttcaacattgtgggcggcgaggacggtgaaggcatcttcatctccttc
atccttgctgggggtccagccgacctcagtggggagctacggaagggggaccagatcctg
tcggtcaatggtgttgacctccgcaatgccagtcatgaacaggctgccattgccctgaag
aacgcgggtcagacggtcacgatcatcgctcagtataaaccagaagagtacagtcgattc
gaggccaagatccatgatcttcgggaacagcttatgaatagtagcctgggctcagggact
gcatccctgcgaagcaaccccaagcggggcttctatatcagggccctgtttgactacgac
aagaccaaggactgcggtttcttgagccaggccctgagcttccactttggggatgtgctt
catgtaattgacgctagcgacgaagagtggtggcaagcgcggcgggtccactctgacagt
gagaccgatgacattggcttcattcccagcaaacggcgggtcgagcgacgagagtggtca
aggttaaaggccaaggactggggctccagctctggatcacagggtcgagaagactcggtt
ctgagctacgagacagtgacgcagatggaagtgcactatgctcgccccatcatcatcctt
gggcctaccaaagaccgtgccaacgatgatcttctctccgagttccccgacaagtttgga
tcctgtgtccctcatacgacacgtcctaagcgggaatatgagatagacggccgcgattac
cactttgtctcctcccgggagaaaatggagaaggacattcaggcgcacaagttcattgag
gctggccagtacaacagccacctctacgggaccagcgtccagtctgtgcgagaggtggca
gagcaggggaagcactgcatccttgatgtctcagccaatgccgtgcggcggctgcaggcg
gcccacctgcaccctatcgccatcttcatccgtccccgctccctggagaatgtgctagag
atcaataagcggatcacagaggagcaagcccggaaagccttcgacagggccacgaagctg
gagcaggagttcacagagtgcttctcagccatcgtcgagggcgacagctttgaagagatc
tatcacaaagtgaagcgtgtcatcgaagacctctcaggcccctacatctgggtcccagcc
cgagagagactctga

KEGG   Mus pahari (shrew mouse): 110333507
Entry
110333507         CDS       T05929                                 

Gene name
Dlg2
Definition
(RefSeq) disks large homolog 2 isoform X1
  KO
K12075  discs large protein 2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04390  Hippo signaling pathway
mpah04530  Tight junction
mpah05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110333507 (Dlg2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110333507 (Dlg2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110333507 (Dlg2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mpah01009]
    110333507 (Dlg2)
Protein phosphatases and associated proteins [BR:mpah01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110333507 (Dlg2)
SSDB
Motif
Pfam: PDZ Guanylate_kin MAGUK_N_PEST L27_1 PDZ_6 PDZ_assoc PDZ_2 SH3_1 SH3_2 SH3_9
Other DBs
NCBI-GeneID: 110333507
NCBI-ProteinID: XP_021070725
Ensembl: MGP_PahariEiJ_G0013208
LinkDB
Position
1
AA seq 1016 aa
MPVKKKGGLCDTDRALSLLEEYCKKLRKPEEQLLKNAVKKVMSIFKSSLFQALLDIQEFY
EVTLLNSQKSCEQKIEEANHVAQKWEKTLLLDSCRDSLQKSSEHTGCSGPKENASYIEQN
KESQCSEIETEEKTCQNHGKCPAQNCSVEAPTWMPVHHCTKYRYQDEDGPHDHSLPRLTH
EVRGPELVHVSEKNLSQIENVHGYVLQSHISPLKASPAPIIVNTDTLDTIPYVNGTEIEY
EFEEITLERGNSGLGFSIAGGTDNPHIGDDPGIFITKIIPGGAAAEDGRLRVNDCILRVN
EVDVSEVSHSKAVEALKEAGSIVRLYVRRRRPILETVVEIKLFKGPKGLGFSIAGGVGNQ
HIPGDNSIYVTKIIDGGAAQKDGRLQVGDRLLMVNNYSLEEVTHEEAVAILKNTSDVVYL
KVGKPTTIYMTDPYGPPDITHSYSPPMENHLLSGNNGTLEYKTSLPPISPGRYSPIPKHM
LVEDDYTRPPEPVYSTVNKLCDKPASPRHYSPVECDKSFLLSSPYPHYHLGLLPDSDMTS
HSQHSTATRQPSVTLQRAISLEGEPRKVVLHKGSTGLGFNIVGGEDGEGIFVSFILAGGP
ADLSGELQRGDQILSVNGIDLRGASHEQAAAALKGAGQTVTIIAQYQPEDYARFEAKIHD
LREQMMNHSMSSGSGSLRTNQKRSLYVRAMFDYDKSKDSGLPSQGLSFKYGDILHVINAS
DDEWWQARRVTLDGDSEEMGVIPSKRRVERKERARLKTVKFNAKPGVIDSKGSFNDKRKK
SFIFSRKFPFYKNKEQSEQETSDPERGQEDLILSYEPVTRQEINYTRPVIILGPMKDRIN
DDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVISREQMEKDIQEHKFIEAGQYNDNL
YGTSVQSVRFVAERGKHCILDVSGNAIKRLQVAQLYPIAIFIKPKSLEPLMEMNKRLTEE
QAKKTYDRAIKLEQEFGEYFTAIVQGDTLEDIYNQCKLVIEEQSGPFIWIPSKEKL
NT seq 3051 nt   +upstreamnt  +downstreamnt
atgccagtcaagaagaaaggtgggctatgtgacactgaccgagctttgtcattactggag
gaatactgcaaaaaattaagaaagcctgaggagcagctgttgaaaaatgctgttaaaaag
gtgatgagtattttcaagagcagcttatttcaagccttactggatattcaagaattttat
gaagtaactctattaaattctcaaaaaagttgcgagcagaagatagaagaagccaatcac
gtggcacagaaatgggagaagactctcctccttgattcatgtcgtgacagtcttcaaaaa
tcctcagagcatacaggttgcagtggaccaaaggaaaatgcttcatacattgagcaaaat
aaagaaagccagtgttctgagattgaaactgaagaaaagacatgtcaaaatcacggcaaa
tgcccagcccagaactgttcagtggaagcccccacctggatgcctgtccaccactgtaca
aagtatcgataccaagatgaggacggtccgcatgatcattccttacctcggctaactcat
gaagtaagaggtccagaacttgtgcatgtgtcggagaagaacctctctcaaatagaaaat
gtccacggatatgtcttacagtctcacatctctcctctgaaggctagccctgctcctata
attgtcaacacagacactttggacactattccttatgtcaatggaacagaaattgaatat
gaatttgaagaaattacattggagaggggaaattcaggcctgggattcagtattgctgga
gggacagataatccccacattggagatgatcctggcatatttattacgaagattattcca
ggaggtgctgcggcagaggatggcagactcagagtcaacgattgcatcttgcgggtgaac
gaagttgatgtgtcagaggtttcccacagtaaagccgtggaagccctcaaggaagccggc
tctattgtgcggctgtacgtgcgtcgaaggcgacccatattggagactgttgtggaaatc
aaactttttaaaggcccaaaaggtttaggcttcagtattgctggaggggtggggaaccag
cacattcctggagacaacagcatttatgtaacaaaaattatagatggcggagctgcacag
aaagatggaaggttgcaagtaggagacagactgctaatggtaaataactatagtttagaa
gaagttacacacgaagaggctgtagcgatattgaagaacacatctgatgttgtttatcta
aaagttggcaaacccaccaccatttatatgactgatccttatgggccaccggatattact
cactcttattctccaccaatggaaaatcatctactgtctggtaacaatggaacgttagaa
tacaaaacttccctgccacccatctctccaggaaggtactcgccaattccaaagcacatg
ctggttgaagatgactacaccaggcctccggaacctgtttacagcactgtgaataaactg
tgtgataagcctgcttctcccaggcactattcccctgttgagtgtgacaaaagcttcctt
ctctcaagtccctacccccactaccacctaggcctgctccctgactctgacatgaccagt
cattcccagcacagtactgcaactcgccagccttcagtgactctgcaacgggccatctcc
ctggaaggggagccccgcaaggtagtccttcacaaaggctccactggcctgggcttcaac
attgtgggcggggaagatggagaaggtatttttgtatccttcattctggccggtggacca
gcagacctgagtggggagctccagagaggagaccagatcttgtcggtgaatggaattgat
ctgcgaggagcatcccatgagcaggcggctgcagcactgaagggggctgggcagaccgtg
acaatcatagcacaatatcaacctgaagattacgctcgatttgaggccaaaatccatgac
ctacgagagcagatgatgaaccacagcatgagctccgggtccgggtcccttcgaaccaat
cagaaacgctccctgtatgtcagagccatgtttgactatgacaagagcaaggacagtggg
ctgcctagccaaggacttagttttaaatatggagacatcctccatgtcatcaatgcctct
gatgatgagtggtggcaagccagaagggtcacactagatggggacagcgaggagatgggc
gtcattcccagcaagcggagggtggaaagaaaggagcgtgcccgattgaagacagtgaag
ttcaatgcaaaacctggcgtgattgattccaaagggtcattcaatgacaagcgtaaaaag
agcttcatcttttcacgaaaattcccattctacaagaacaaggagcagagtgagcaggaa
accagtgatcctgaacgaggacaagaagatctcattctttcctatgaacctgtcacgagg
caggaaataaactatacccggcccgtgataatcctgggccccatgaaggatcgaatcaat
gatgacttgatatctgaatttcctgataaatttggctcctgtgtgcctcatactacgagg
ccaaagcgtgactacgaagtcgacggcagagactatcactttgtcatctctagagaacaa
atggagaaggatatccaagagcacaaatttatagaagctggccagtacaatgacaattta
tacggaaccagtgtgcagtctgtgagatttgtagcagaaaggggcaagcactgtatactt
gatgtatcgggaaatgctattaagcggttacaagtcgcccagctctatcccattgccatc
ttcataaagcccaagtctctggaacctctgatggagatgaataagcgtctgacagaggaa
caagccaagaaaacttatgaccgggcaattaaactagaacaagaatttggagaatatttt
acagctattgtccaaggagataccttagaagatatttacaaccaatgcaagcttgttatt
gaagagcagtctggacctttcatctggattccctcaaaggagaagttataa

DBGET integrated database retrieval system