KEGG   Mus pahari (shrew mouse): 110314286
Entry
110314286         CDS       T05929                                 

Gene name
Elk1
Definition
(RefSeq) ETS domain-containing protein Elk-1
  KO
K04375  ETS domain-containing protein Elk-1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04010  MAPK signaling pathway
mpah04012  ErbB signaling pathway
mpah04014  Ras signaling pathway
mpah04510  Focal adhesion
mpah04910  Insulin signaling pathway
mpah04912  GnRH signaling pathway
mpah04921  Oxytocin signaling pathway
mpah05140  Leishmaniasis
mpah05161  Hepatitis B
mpah05163  Human cytomegalovirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05213  Endometrial cancer
mpah05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110314286 (Elk1)
   04012 ErbB signaling pathway
    110314286 (Elk1)
   04014 Ras signaling pathway
    110314286 (Elk1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110314286 (Elk1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110314286 (Elk1)
   04912 GnRH signaling pathway
    110314286 (Elk1)
   04921 Oxytocin signaling pathway
    110314286 (Elk1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110314286 (Elk1)
   05205 Proteoglycans in cancer
    110314286 (Elk1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110314286 (Elk1)
   05213 Endometrial cancer
    110314286 (Elk1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110314286 (Elk1)
   05161 Hepatitis B
    110314286 (Elk1)
   05163 Human cytomegalovirus infection
    110314286 (Elk1)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    110314286 (Elk1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110314286 (Elk1)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    110314286 (Elk1)
SSDB
Motif
Pfam: Ets
Other DBs
NCBI-GeneID: 110314286
NCBI-ProteinID: XP_021044383
Ensembl: MGP_PahariEiJ_G0031514
LinkDB
Position
X
AA seq 431 aa
MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKL
SRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSAIAMAPATVHA
GPGDTATGKPGTPKGAGMTGQGGLARSSRNEYMRSGLYSTFTIQSLQPQPQLQPPIHPRP
ASVLPNTTPAGVPAPASGSRSTSPNPLEACLEAEEAGLPLQVILTPPEAPNQKSEELSLD
PSFGHPQPPEVKVEGPKEELEAARVGGFSSEAVKAEPEVSPSEGLLARLPAILTENTAQV
CGLSTSTTEITQPQKGRKPRDLELPLSPSLLSGQGPERTPGSGTSSGLQAPGPALTPSLL
PTHTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLST
PVVLSPGPQKP
NT seq 1296 nt   +upstreamnt  +downstreamnt
atggacccatctgtgacgctgtggcagtttctgctgcagcttctgagagaacaaggtaat
ggccacatcatctcctggacctcacgggatggtggtgagttcaagttggtggatgcagag
gaggtggcccggctatggggactgcgcaagaacaagaccaacatgaattatgacaagctt
agccgggccttgcggtactactatgataagaatatcatccgcaaggtgagcggccagaag
tttgtctacaagtttgtgtcctacccagaggttgcagggtgctccactgaagactgccca
ccccagcctgaggtgtctgtaacctcggccatagccatggcccctgctactgtccatgca
ggcccaggggacactgccactggaaagccaggaacaccaaagggtgcaggaatgacaggc
caaggtggcttagcacgaagcagccggaatgaatacatgcgctcgggcctctattctacc
ttcacaatacagtccctgcagccacagccacagctacagccacccattcatcctcggcct
gcctcagtgcttcccaacactacccctgcaggagtaccagcacccgcctcagggagcagg
agcaccagtccaaaccccttagaagcctgtttggaggcagaagaggctggtctgcccctg
caggttatcctgacccccccagaggccccaaaccagaaatccgaagagttgagtctggac
ccaagttttggccatccacagcccccagaagtcaaggtggaggggcctaaggaagaattg
gaagctgcaagggttggaggcttcagttcagaagctgtcaaagctgaaccagaagtctca
ccctcagaaggcctgctggctcggctcccagccatcctaacagagaatacagcacaggtg
tgtggcctttccacttccaccactgagatcacccaaccccagaagggccggaagcctcgg
gacctggaacttccacttagcccaagcctgctgagtggccagggacctgaacggactcca
ggatcaggaacaagctctggtcttcaggcaccggggccagcactaacgccatccctgctc
cccacacataccttgaccccggtgctgctgacacccagctcgctgccccccagcatccat
ttctggagcactctgagtccaattgcaccccgtagtccagccaagctctccttccagttt
ccgtccagtggcagcgcacaggtgcacatcccttccatcagcgtggatggcctctcgacc
cccgtggtgctctccccagggccccagaagccatga

DBGET integrated database retrieval system