KEGG   Mus pahari (shrew mouse): 110314361Help
Entry
110314361         CDS       T05929                                 

Definition
(RefSeq) probasin
Organism
mpah  Mus pahari (shrew mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Lipocalin DUF1128
Motif
Other DBs
NCBI-GeneID: 110314361
NCBI-ProteinID: XP_021044426
Ensembl: MGP_PahariEiJ_G0031748
LinkDB All DBs
Position
X
AA seq 177 aa AA seqDB search
MMRVILLLLTLHVLGVSSVMRNKSLKKKIEGPWRTIYLAASTKEKINEGSPLRTYFRLIL
CGKRCNQVYLYFFIKKGTKCQLHKVLGRKKQEVYYAQYEGSTAFMLKMVNEKILLFHYFN
KNRRNDVTRVAGVLAKGKQLNKEEMTEFMNLVEEMGIEEENVQRIMDTDNCPSKIKS
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgatgagggtcatcctcctcctgctcacactgcatgtgctaggcgtctccagtgtgatg
aggaataagagtctcaaaaagaagattgaagggccttggcgaacaatttacttagctgcc
agtaccaaggagaagataaatgaaggctcaccattgaggacctacttccgtctcattttg
tgtgggaagagatgcaaccaagtctacctctatttttttattaagaaagggaccaagtgc
caactgcataaagtcttaggaaggaaaaaacaagaagtttactatgcacagtatgaaggg
agcacagcattcatgttaaagatggtaaatgagaagatattgttgtttcactattttaac
aaaaacagaagaaacgacgtcacacgagtggctggagttttggcaaagggcaaacaactg
aataaggaggagatgacagagttcatgaacttagtggaagaaatgggcattgaggaagag
aatgtgcagcgtatcatggacacagacaactgtccaagcaagatcaaatcttag

DBGET integrated database retrieval system